CRABP2, Human (His)
CRABP2 (cellular retinoic acid binding protein 2) plays a crucial role in cellular processes by transporting retinoic acid into the nucleus and mediating its contact with nuclear retinoic acid receptors. CRABP2 interacts with RXR (retinoic acid X receptor) and RARA (retinoic acid receptor Alpha) to regulate the retinoic acid signaling pathway. CRABP2 Protein, Human (His) is the recombinant human-derived CRABP2 protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
CRABP2 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/crabp2-protein-human-his.html
Purity
95.00
Smiles
PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
Molecular Formula
1382 (Gene_ID) P29373 (P2-E138) (Accession)
Molecular Weight
Approximately 16 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Human A Disintegrin And Metalloprotease 10 (ADAM10) ELISA Kit
Human A Disintegrin And Metalloprotease 10 (ADAM10) ELISA Kit
CD22 / BL-CAM (B-Cell Marker) (BLCAM/1796), CF568 conjugate, 0.1mg/mL
![CD16 (FCGR3A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI12D8]](https://cdn.genprice.uk/products/937/68dd1b88061270361ea2147c/imageurl/ta813633bm.webp)
CD16 (FCGR3A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI12D8]
