Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRABP2, Human (His)

CRABP2 (cellular retinoic acid binding protein 2) plays a crucial role in cellular processes by transporting retinoic acid into the nucleus and mediating its contact with nuclear retinoic acid receptors. CRABP2 interacts with RXR (retinoic acid X receptor) and RARA (retinoic acid receptor Alpha) to regulate the retinoic acid signaling pathway. CRABP2 Protein, Human (His) is the recombinant human-derived CRABP2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

CRABP2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/crabp2-protein-human-his.html

Purity

95.00

Smiles

PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE

Molecular Formula

1382 (Gene_ID) P29373 (P2-E138) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LHX3 (NM_178138) Human Tagged Lenti ORF Clone
RC216247L2 10 µg

LHX3 (NM_178138) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Butyrolactone 3
sc-358657B 100 mg

Butyrolactone 3

Sign In for Pricing
View Details
CD9 Rabbit Polyclonal Antibody
orb2950995-01 50 µg

CD9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD9 Rabbit Polyclonal Antibody
orb2950995-02 100 µg

CD9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPATA24 Protein Lysate (Mouse) with C-HA Tag
45224034 100 µg

SPATA24 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
DEGP12 Antibody, FITC conjugated
A68368-50UG 50 µg

DEGP12 Antibody, FITC conjugated

Sign In for Pricing
View Details