Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DiagNano Recombinant Syphilis (15 kDa) Conjugated Gold Nanoparticles
DAGC578-01 5 mL

DiagNano Recombinant Syphilis (15 kDa) Conjugated Gold Nanoparticles

Sign In for Pricing
View Details
DiagNano Recombinant Syphilis (15 kDa) Conjugated Gold Nanoparticles
DAGC578-02 1 mg

DiagNano Recombinant Syphilis (15 kDa) Conjugated Gold Nanoparticles

Sign In for Pricing
View Details
Human DNMT1 (Δexons3-5/+); DNMT3B (-/-); CDKN2A (R24fs*20/-) HCT116 Cell Line
ABC-KD4343 1 Vial

Human DNMT1 (Δexons3-5/+); DNMT3B (-/-); CDKN2A (R24fs*20/-) HCT116 Cell Line

Sign In for Pricing
View Details
Anti-Homer1 Antibody (L113/27)
HV484033-01 50 µg

Anti-Homer1 Antibody (L113/27)

Sign In for Pricing
View Details
Anti-Homer1 Antibody (L113/27)
HV484033-02 100 µg

Anti-Homer1 Antibody (L113/27)

Sign In for Pricing
View Details
Anti-Homer1 Antibody (L113/27)
HV484033-03 1 mg

Anti-Homer1 Antibody (L113/27)

Sign In for Pricing
View Details