Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ctsa Mouse siRNA Oligo Duplex (Locus ID 19025)
SR415341 1 Kit

Ctsa Mouse siRNA Oligo Duplex (Locus ID 19025)

Sign In for Pricing
View Details
Mouse Putative ataxin-7-like protein 3B (ATXN7L3B) ELISA Kit
abx500292 96 Tests

Mouse Putative ataxin-7-like protein 3B (ATXN7L3B) ELISA Kit

Sign In for Pricing
View Details
REG1 alpha Blocking Peptide
MBS9631678-01 1 mg

REG1 alpha Blocking Peptide

Sign In for Pricing
View Details
REG1 alpha Blocking Peptide
MBS9631678-02 5x 1 mg

REG1 alpha Blocking Peptide

Sign In for Pricing
View Details
GNAI2 (Guanine Nucleotide-binding Protein G (i) Subunit alpha-2, Adenylate Cyclase-inhibiting G alpha Protein, GNAI2B)
318186 100 µL

GNAI2 (Guanine Nucleotide-binding Protein G (i) Subunit alpha-2, Adenylate Cyclase-inhibiting G alpha Protein, GNAI2B)

Sign In for Pricing
View Details
Otc Rabbit Polyclonal Antibody
TA362911 100 µL

Otc Rabbit Polyclonal Antibody

Sign In for Pricing
View Details