Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

P-cadherin (A-10) Alexa Fluor® 680
sc-74545 AF680 200 µg/mL

P-cadherin (A-10) Alexa Fluor® 680

Sign In for Pricing
View Details
Mouse Monoclonal SREBP1 Antibody (SREBP1/1578) [DyLight 650]
NBP3-08432C 100 µL

Mouse Monoclonal SREBP1 Antibody (SREBP1/1578) [DyLight 650]

Sign In for Pricing
View Details
N-alpha-Z-D-lysine benzyl ester benzenesulfonate salt
281436 1 g

N-alpha-Z-D-lysine benzyl ester benzenesulfonate salt

Sign In for Pricing
View Details
Human Gastric Intrinsic Factor (GIF) ELISA Kit
SL4517Hu-01 96 Tests

Human Gastric Intrinsic Factor (GIF) ELISA Kit

Sign In for Pricing
View Details
Human Gastric Intrinsic Factor (GIF) ELISA Kit
SL4517Hu-02 48 Tests

Human Gastric Intrinsic Factor (GIF) ELISA Kit

Sign In for Pricing
View Details
Anti-CD41a antibody
STJ16100078 1 mL

Anti-CD41a antibody

Sign In for Pricing
View Details