Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human EFNA1 Protein, C-His (Active)
AHD42701 100 μg

Recombinant Human EFNA1 Protein, C-His (Active)

Sign In for Pricing
View Details
Human Meiotic Recombination Protein 5 (MEI5) ELISA Kit
QY-E02872 96 Tests

Human Meiotic Recombination Protein 5 (MEI5) ELISA Kit

Sign In for Pricing
View Details
RPL23AP43 sgRNA CRISPR Lentivector (Human) (Target 3)
K1942604 1.0 µg DNA

RPL23AP43 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
EAAT1 discontinued
388523 200 µL

EAAT1 discontinued

Sign In for Pricing
View Details
ATP6V0E1 Human shRNA Plasmid Kit (Locus ID 8992)
TL320086 1 Kit

ATP6V0E1 Human shRNA Plasmid Kit (Locus ID 8992)

Sign In for Pricing
View Details
Rabbit Monoclonal ABCA1 Antibody (1276B) [Allophycocyanin]
NBP2-54792APC 0.1 mL

Rabbit Monoclonal ABCA1 Antibody (1276B) [Allophycocyanin]

Sign In for Pricing
View Details