Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tram1l1 3'UTR Lenti-reporter-Luc Vector
47506084 1.0 µg

Tram1l1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Gpank1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7584508 1.0 µg DNA

Gpank1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Recombinant Rat GRIK3 Protein, His (Fc)-Avi-tagged
GRIK3-2351R 50 µg

Recombinant Rat GRIK3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
[1,1'-Biphenyl]-4-yl (phenyl) methanol
OR1040436-01 100 mg

[1,1'-Biphenyl]-4-yl (phenyl) methanol

Sign In for Pricing
View Details
[1,1'-Biphenyl]-4-yl (phenyl) methanol
OR1040436-02 250 mg

[1,1'-Biphenyl]-4-yl (phenyl) methanol

Sign In for Pricing
View Details
[1,1'-Biphenyl]-4-yl (phenyl) methanol
OR1040436-03 1 g

[1,1'-Biphenyl]-4-yl (phenyl) methanol

Sign In for Pricing
View Details