Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM32 CRISPRa sgRNA lentivector (set of three targets)(Rat)
47770126 3x 1.0µg DNA

TRIM32 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Recombinant Ustilago maydis Nascent polypeptide-associated complex subunit beta (EGD1)
MBS1383668-01 0.02 mg (E-Coli)

Recombinant Ustilago maydis Nascent polypeptide-associated complex subunit beta (EGD1)

Sign In for Pricing
View Details
Recombinant Ustilago maydis Nascent polypeptide-associated complex subunit beta (EGD1)
MBS1383668-02 0.1 mg (E-Coli)

Recombinant Ustilago maydis Nascent polypeptide-associated complex subunit beta (EGD1)

Sign In for Pricing
View Details
Recombinant Ustilago maydis Nascent polypeptide-associated complex subunit beta (EGD1)
MBS1383668-03 0.02 mg (Yeast)

Recombinant Ustilago maydis Nascent polypeptide-associated complex subunit beta (EGD1)

Sign In for Pricing
View Details
Recombinant Ustilago maydis Nascent polypeptide-associated complex subunit beta (EGD1)
MBS1383668-04 0.1 mg (Yeast)

Recombinant Ustilago maydis Nascent polypeptide-associated complex subunit beta (EGD1)

Sign In for Pricing
View Details
Recombinant Ustilago maydis Nascent polypeptide-associated complex subunit beta (EGD1)
MBS1383668-05 0.02 mg (Baculovirus)

Recombinant Ustilago maydis Nascent polypeptide-associated complex subunit beta (EGD1)

Sign In for Pricing
View Details