Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRABD Protein Vector (Rat) (pPB-N-His)
PV312651 500 ng

TRABD Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Alanine Aminotransferase (ALT) BioAssayTM ECL ELISA Kit (Rat)
157373 96 Tests

Alanine Aminotransferase (ALT) BioAssayTM ECL ELISA Kit (Rat)

Sign In for Pricing
View Details
SLC35C2 Protein Vector (Mouse) (pPB-N-His)
PV230623 500 ng

SLC35C2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
ZNF608 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2719405 3x 1.0 µg

ZNF608 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Cat C-telopeptide of type I collagen, CTX-I ELISA Kit
MBS1602650-01 48 Well

Cat C-telopeptide of type I collagen, CTX-I ELISA Kit

Sign In for Pricing
View Details
Cat C-telopeptide of type I collagen, CTX-I ELISA Kit
MBS1602650-02 96 Well

Cat C-telopeptide of type I collagen, CTX-I ELISA Kit

Sign In for Pricing
View Details