Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FNDC4 Mouse Monoclonal Antibody [Clone ID: OTI3B11]
CF505462 100 µg

FNDC4 Mouse Monoclonal Antibody [Clone ID: OTI3B11]

Sign In for Pricing
View Details
FUBP1 Recombinant Antibody, PE-Cy5.5 Conjugated
bsm-60625R-PE-Cy5.5 100 µL

FUBP1 Recombinant Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
PRSS23 Protein Vector (Rat) (pPM-C-HA)
PV296600 500 ng

PRSS23 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
C12orf26 Recombinant Protein (Human)
RP003610 100 µg

C12orf26 Recombinant Protein (Human)

Sign In for Pricing
View Details
Sex Hormone Binding Globulin (FITC)
549920 200 µL

Sex Hormone Binding Globulin (FITC)

Sign In for Pricing
View Details
Rat TBX2 (T-Box Protein 2) ValidElisa Kit
EK342146 96 Well

Rat TBX2 (T-Box Protein 2) ValidElisa Kit

Sign In for Pricing
View Details