Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr560 (NM_001000325) Rat Tagged ORF Clone Lentiviral Particle
RR214451L3V 200 µL

Olr560 (NM_001000325) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
COX10 Human qPCR Primer Pair (NM_001303)
HP205215 200 Reactions

COX10 Human qPCR Primer Pair (NM_001303)

Sign In for Pricing
View Details
Caskin1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7054206 1.0 µg DNA

Caskin1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Recombinant ASFV War-034 Protein (aa 1-353)
VAng-0998Lsx-50g 50 µg

Recombinant ASFV War-034 Protein (aa 1-353)

Sign In for Pricing
View Details
Rabbit Polyclonal p73 Antibody [Alexa Fluor 488]
NB100-420AF488 0.1 mL

Rabbit Polyclonal p73 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
FES Antibody
MBS9407272-01 0.05 mL

FES Antibody

Sign In for Pricing
View Details