Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Orexin B/Hypocretin-2 Antibody (MM0501-5G21) [Alexa Fluor 350]
NBP2-11834AF350 0.1 mL

Mouse Monoclonal Orexin B/Hypocretin-2 Antibody (MM0501-5G21) [Alexa Fluor 350]

Sign In for Pricing
View Details
NCS1 Antibody
MBS5312018-01 0.1 mL

NCS1 Antibody

Sign In for Pricing
View Details
NCS1 Antibody
MBS5312018-02 5x 0.1 mL

NCS1 Antibody

Sign In for Pricing
View Details
PLAC8 Human shRNA Plasmid Kit (Locus ID 51316)
TL302451 1 Kit

PLAC8 Human shRNA Plasmid Kit (Locus ID 51316)

Sign In for Pricing
View Details
Furathiocarb - 1ML
S-5464 1 mL

Furathiocarb - 1ML

Sign In for Pricing
View Details
HES1 (NM_005524) Human Over-expression Lysate
LY417251 100 µg

HES1 (NM_005524) Human Over-expression Lysate

Sign In for Pricing
View Details