Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncharacterized protein C20orf195 (C20orf195) Human ELISA Kit
I0968 96 Tests

Uncharacterized protein C20orf195 (C20orf195) Human ELISA Kit

Sign In for Pricing
View Details
Phospho-Catenin-β (Tyr489) Cell-Based ELISA Kit
FLUO-CBP1711 1 Kit

Phospho-Catenin-β (Tyr489) Cell-Based ELISA Kit

Sign In for Pricing
View Details
Nhlrc4 Mouse shRNA Lentiviral Particle (Locus ID 621239)
TL508954V 500 µL Each

Nhlrc4 Mouse shRNA Lentiviral Particle (Locus ID 621239)

Sign In for Pricing
View Details
Anti-ACSL6 Polyclonal Antibody
HP520014-01 50 µg

Anti-ACSL6 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-ACSL6 Polyclonal Antibody
HP520014-02 100 µg

Anti-ACSL6 Polyclonal Antibody

Sign In for Pricing
View Details
Apom (NM_018816) Mouse Tagged ORF Clone Lentiviral Particle
MR201811L4V 200 µL

Apom (NM_018816) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details