Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Pappalysin 2 (PAPPA2) ELISA Kit
RD-PAPPA2-Hu-01 96 Tests

Human Pappalysin 2 (PAPPA2) ELISA Kit

Sign In for Pricing
View Details
Human Pappalysin 2 (PAPPA2) ELISA Kit
RD-PAPPA2-Hu-02 48 Tests

Human Pappalysin 2 (PAPPA2) ELISA Kit

Sign In for Pricing
View Details
ANKRD23 Antibody, Biotin conjugated
A60583-100UG 100 µg

ANKRD23 Antibody, Biotin conjugated

Sign In for Pricing
View Details
DPYSL3 Rabbit pAb
E45R18936N-100 100 µL

DPYSL3 Rabbit pAb

Sign In for Pricing
View Details
Fbxo21 ORF Vector (Mouse) (pORF)
20315014 1.0 µg DNA

Fbxo21 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
P27Kip1 (CDKN1B, CDKN4, Cyclin Dependent Kinase Inhibitor 1B, Cyclin-dependent kinase inhibitor p27 Kip1, KIP1, MEN1B, MEN4) (BSA & Azide Free) (MaxLight 550)
168847-AF-ML550 100 µL

P27Kip1 (CDKN1B, CDKN4, Cyclin Dependent Kinase Inhibitor 1B, Cyclin-dependent kinase inhibitor p27 Kip1, KIP1, MEN1B, MEN4) (BSA & Azide Free) (MaxLight 550)

Sign In for Pricing
View Details