Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1700129C05Rik (NM_026461) Mouse Tagged ORF Clone
MG202447 10 µg

1700129C05Rik (NM_026461) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GLULP6 Protein Vector (Human) (pPM-C-His)
PV080912 500 ng

GLULP6 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
C16orf57 sgRNA CRISPR Lentivector set (Human)
K0312001 3x 1.0 µg

C16orf57 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Tripolin B
GL9093-1mg 1 mg

Tripolin B

Sign In for Pricing
View Details
Serpinb6e (NM_001045535) Mouse Tagged ORF Clone Lentiviral Particle
MR212380L4V 200 µL

Serpinb6e (NM_001045535) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Potassium tartrate dibasic hemihydrate
P7091 500 g

Potassium tartrate dibasic hemihydrate

Sign In for Pricing
View Details