Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-[2- (2,4-Difluorophenyl) -2,3-epoxypropyl]-1H-1,2,4-triazole
009587 100 mg

1-[2- (2,4-Difluorophenyl) -2,3-epoxypropyl]-1H-1,2,4-triazole

Sign In for Pricing
View Details
К electrode
A11-120 1 unit

К electrode

Sign In for Pricing
View Details
CFTR corrector 9
MF-0018485-01 2 mg

CFTR corrector 9

Sign In for Pricing
View Details
CFTR corrector 9
MF-0018485-02 1 mL - 10 mM (in DMSO)

CFTR corrector 9

Sign In for Pricing
View Details
CFTR corrector 9
MF-0018485-03 5 mg

CFTR corrector 9

Sign In for Pricing
View Details
CFTR corrector 9
MF-0018485-04 10 mg

CFTR corrector 9

Sign In for Pricing
View Details