Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAPGEF5, CT (RAPGEF5, GFR, KIAA0277, MRGEF, Rap guanine nucleotide exchange factor 5, Guanine nucleotide exchange factor for Rap1, M-Ras-regulated Rap GEF, Related to Epac) (MaxLight 405) discontinued
040834-ML405 100 µL

RAPGEF5, CT (RAPGEF5, GFR, KIAA0277, MRGEF, Rap guanine nucleotide exchange factor 5, Guanine nucleotide exchange factor for Rap1, M-Ras-regulated Rap GEF, Related to Epac) (MaxLight 405) discontinued

Sign In for Pricing
View Details
DDX18P3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0572306 1.0 µg DNA

DDX18P3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Mouse Monoclonal IgJ Antibody (OTI3B3) [PE/Cy5.5]
NBP2-71016PECY55 0.1 mL

Mouse Monoclonal IgJ Antibody (OTI3B3) [PE/Cy5.5]

Sign In for Pricing
View Details
Human Hemoglobin A1a, A1b mixture 1.0 mg
HbA2 1 mg

Human Hemoglobin A1a, A1b mixture 1.0 mg

Sign In for Pricing
View Details
PBXIP1 Over-expression Lysate Product
GWB-79D500 0.1 mg

PBXIP1 Over-expression Lysate Product

Sign In for Pricing
View Details
LAIR2 protein, Human, Recombinant (His)
E51P90006 20 µg

LAIR2 protein, Human, Recombinant (His)

Sign In for Pricing
View Details