Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE1L / UBE2 Recombinant Antibody, RBITC Conjugated
bsm-62787R-RBITC 100 µL

UBE1L / UBE2 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Gem Blocking Peptide
33R-7463 100 ug

Gem Blocking Peptide

Sign In for Pricing
View Details
Rabbit Polyclonal COMMD8 Antibody
NBP3-00352-100ul 100 µL

Rabbit Polyclonal COMMD8 Antibody

Sign In for Pricing
View Details
Human HSP90AB1 shRNA Plasmid
abx952271-01 150 µg

Human HSP90AB1 shRNA Plasmid

Sign In for Pricing
View Details
Human HSP90AB1 shRNA Plasmid
abx952271-02 300 µg

Human HSP90AB1 shRNA Plasmid

Sign In for Pricing
View Details
SNAI3 Protein Vector (Rat) (pPB-C-His)
PV306942 500 ng

SNAI3 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details