Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ehf shRNA (UAS) - Lentiviral mouse Ehf shRNA (UAS, iRFP) (25)
GTR15279578 1 Vial

Lentiviral mouse Ehf shRNA (UAS) - Lentiviral mouse Ehf shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Epidermal Growth Factor Receptor (erbB, EGFR) (FITC)
MBS6249844-01 0.1 mL

Epidermal Growth Factor Receptor (erbB, EGFR) (FITC)

Sign In for Pricing
View Details
Epidermal Growth Factor Receptor (erbB, EGFR) (FITC)
MBS6249844-02 5x 0.1 mL

Epidermal Growth Factor Receptor (erbB, EGFR) (FITC)

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni gpmI Protein (aa 1-492) (strain 81-176)
VAng-Ly2658-1mgEcoli 1 mg (E. coli)

Recombinant Campylobacter Jejuni gpmI Protein (aa 1-492) (strain 81-176)

Sign In for Pricing
View Details
Monkey Chemokine Like Factor ELISA Kit
MBS749266-01 48 Well

Monkey Chemokine Like Factor ELISA Kit

Sign In for Pricing
View Details
Monkey Chemokine Like Factor ELISA Kit
MBS749266-02 96 Well

Monkey Chemokine Like Factor ELISA Kit

Sign In for Pricing
View Details