Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Complement component C8 alpha chain, C8A ELISA Kit
MBS1606028-01 48 Well

Human Complement component C8 alpha chain, C8A ELISA Kit

Sign In for Pricing
View Details
Human Complement component C8 alpha chain, C8A ELISA Kit
MBS1606028-02 96 Well

Human Complement component C8 alpha chain, C8A ELISA Kit

Sign In for Pricing
View Details
Human Complement component C8 alpha chain, C8A ELISA Kit
MBS1606028-03 5x 96 Well

Human Complement component C8 alpha chain, C8A ELISA Kit

Sign In for Pricing
View Details
Human Complement component C8 alpha chain, C8A ELISA Kit
MBS1606028-04 10x 96 Well

Human Complement component C8 alpha chain, C8A ELISA Kit

Sign In for Pricing
View Details
Human Primary Synovial Fibroblasts Cells
AFG-ELL-0453 > 5x 10^5 Cells / Vial

Human Primary Synovial Fibroblasts Cells

Sign In for Pricing
View Details
PLV3-U6-RBM39 (human) -shRNA1-Puro
BZ56979 1 Vial

PLV3-U6-RBM39 (human) -shRNA1-Puro

Sign In for Pricing
View Details