Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIT, ID (T354) (KIT, SCFR, Mast/stem cell growth factor receptor Kit, Piebald trait protein, Proto-oncogene c-Kit, Tyrosine-protein kinase Kit, p145 c-kit, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, CD117) (PE) discontinued
037486-PE 200 µL

KIT, ID (T354) (KIT, SCFR, Mast/stem cell growth factor receptor Kit, Piebald trait protein, Proto-oncogene c-Kit, Tyrosine-protein kinase Kit, p145 c-kit, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, CD117) (PE) discontinued

Sign In for Pricing
View Details
Bcl2 modifying factor Recombinant Antibody, Biotin Conjugated
bsm-62132R-Biotin 100 µL

Bcl2 modifying factor Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
TATU
5-02176 100 g

TATU

Sign In for Pricing
View Details
Vpreb2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3419703 1.0 µg DNA

Vpreb2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
LPHN2 Protein Vector (Human) (pPM-C-His)
PV092273 500 ng

LPHN2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Human BLyS / TNFSF13B / BAFF Protein
E53A06329 50 µg

Recombinant Human BLyS / TNFSF13B / BAFF Protein

Sign In for Pricing
View Details