Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FADD Antibody
NBP1-81831-25ul 25 µL

Rabbit Polyclonal FADD Antibody

Sign In for Pricing
View Details
Gm3286 (NM_001167793) Mouse Tagged Lenti ORF Clone
MR207706L4 10 µg

Gm3286 (NM_001167793) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DDX28 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0573608 1.0 µg DNA

DDX28 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Cyclin D1 (CCND1) Antibody
abx140376 0.1 mg

Cyclin D1 (CCND1) Antibody

Sign In for Pricing
View Details
Mouse mmu-miR-7049-5p miRNA Antagomir
abx889403-01 10 nmol

Mouse mmu-miR-7049-5p miRNA Antagomir

Sign In for Pricing
View Details
Mouse mmu-miR-7049-5p miRNA Antagomir
abx889403-02 20 nmol

Mouse mmu-miR-7049-5p miRNA Antagomir

Sign In for Pricing
View Details