Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UPK1A antibody
FNab09273 100 µg

UPK1A antibody

Sign In for Pricing
View Details
Human IL-33 MAb (Clone 40015C)
MAB36253-100 100 µg

Human IL-33 MAb (Clone 40015C)

Sign In for Pricing
View Details
Naa35 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7588208 1.0 µg DNA

Naa35 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Eukaryotic Translation Initiation Factor 3A (EIF3A)
MBS2060258-01 0.1 mL

HRP-Linked Polyclonal Antibody to Eukaryotic Translation Initiation Factor 3A (EIF3A)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Eukaryotic Translation Initiation Factor 3A (EIF3A)
MBS2060258-02 0.2 mL

HRP-Linked Polyclonal Antibody to Eukaryotic Translation Initiation Factor 3A (EIF3A)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Eukaryotic Translation Initiation Factor 3A (EIF3A)
MBS2060258-03 0.5 mL

HRP-Linked Polyclonal Antibody to Eukaryotic Translation Initiation Factor 3A (EIF3A)

Sign In for Pricing
View Details