Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX18 Human shRNA Plasmid Kit (Locus ID 112574)
TL307432 1 Kit

SNX18 Human shRNA Plasmid Kit (Locus ID 112574)

Sign In for Pricing
View Details
Col14a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3394306 1.0 µg DNA

Col14a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
DRA Antibody
E38QA5930 100 µL

DRA Antibody

Sign In for Pricing
View Details
RAB11B Antibody, HRP conjugated
A54541-50UG 50 µg

RAB11B Antibody, HRP conjugated

Sign In for Pricing
View Details
ADORA2B Antibody, FITC conjugated
A12033-50UG 50 µg

ADORA2B Antibody, FITC conjugated

Sign In for Pricing
View Details
Sstr5 AAV siRNA Pooled Vector
45558164 1.0 µg

Sstr5 AAV siRNA Pooled Vector

Sign In for Pricing
View Details