Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plasminogen (MaxLight 550) discontinued
P4256-25M-ML550 100 µL

Plasminogen (MaxLight 550) discontinued

Sign In for Pricing
View Details
Olfr1491 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4159303 1.0 µg DNA

Olfr1491 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
ZC3H12A Antibody
MBS9412090-01 0.1 mL

ZC3H12A Antibody

Sign In for Pricing
View Details
ZC3H12A Antibody
MBS9412090-02 5x 0.1 mL

ZC3H12A Antibody

Sign In for Pricing
View Details
WBP2 AAV Vector (Human) (CMV)
50275101 1 µg

WBP2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Mouse Carbonic Anhydrase 2 (CA2) ELISA Kit
abx258801-01 96 Tests

Mouse Carbonic Anhydrase 2 (CA2) ELISA Kit

Sign In for Pricing
View Details