Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPG3A (atlastin GTPase 1, AD-FSP, FSP1, GBP3, SPG3, SPG3A, atlastin1) (AP) discontinued
252042-AP 100 µL

SPG3A (atlastin GTPase 1, AD-FSP, FSP1, GBP3, SPG3, SPG3A, atlastin1) (AP) discontinued

Sign In for Pricing
View Details
SerpinA1/A1AT, Recombinant, Rat, His-Tag discontinued
591502-01 20 µg

SerpinA1/A1AT, Recombinant, Rat, His-Tag discontinued

Sign In for Pricing
View Details
SerpinA1/A1AT, Recombinant, Rat, His-Tag discontinued
591502-02 100 µg

SerpinA1/A1AT, Recombinant, Rat, His-Tag discontinued

Sign In for Pricing
View Details
Lentiviral mouse Hmga2 shRNA (UAS) - Lentiviral mouse Hmga2 shRNA (UAS) plasmid
GTR15157183 1 Vial

Lentiviral mouse Hmga2 shRNA (UAS) - Lentiviral mouse Hmga2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
PLA2G10 (Group 10 Secretory Phospholipase A2, Group X Secretory Phospholipase A2, GX sPLA2, sPLA2-X, Phosphatidylcholine 2-acylhydrolase 10, MGC119918, MGC119919, MGC133367)
131413 50 µg

PLA2G10 (Group 10 Secretory Phospholipase A2, Group X Secretory Phospholipase A2, GX sPLA2, sPLA2-X, Phosphatidylcholine 2-acylhydrolase 10, MGC119918, MGC119919, MGC133367)

Sign In for Pricing
View Details
L.J.Medium Slant w/ Moxifoxacin (2.5mcg/
SL189L-25SL 1 unit

L.J.Medium Slant w/ Moxifoxacin (2.5mcg/

Sign In for Pricing
View Details