Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lipase ELISA Kit
CN-04596H2 48T

Human Lipase ELISA Kit

Sign In for Pricing
View Details
PDCD4, ID (PDCD4, H731, Programmed cell death protein 4, Neoplastic transformation inhibitor protein, Nuclear antigen H731-like, Protein 197/15a) (Biotin) discontinued
039789-Biotin 200 µL

PDCD4, ID (PDCD4, H731, Programmed cell death protein 4, Neoplastic transformation inhibitor protein, Nuclear antigen H731-like, Protein 197/15a) (Biotin) discontinued

Sign In for Pricing
View Details
Kcnj5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3825105 3x 1.0 µg

Kcnj5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human Peritoneal Mesothelial Cells
RPC-071 5x 10^5

Human Peritoneal Mesothelial Cells

Sign In for Pricing
View Details
Kcns2 Rabbit Polyclonal Antibody
TA363391 100 µL

Kcns2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Rnf43 Pre-designed siRNA Set B
SI212066B 1 Each

Rat Rnf43 Pre-designed siRNA Set B

Sign In for Pricing
View Details