Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CPEB1 Protein, His-SUMO, E.coli-500ug
QP8045-ec-500ug 500ug

Recombinant Human CPEB1 Protein, His-SUMO, E.coli-500ug

Sign In for Pricing
View Details
Lentiviral human KLK6 shRNA (UAS) - Lentiviral human KLK6 shRNA (UAS, iRFP) (100)
GTR15324750 1 Vial

Lentiviral human KLK6 shRNA (UAS) - Lentiviral human KLK6 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Box of 25 Sheets of Glass Microfibre Filter 0.7µm, 203X254 Mm
FV25F2025W Box of 25

Box of 25 Sheets of Glass Microfibre Filter 0.7µm, 203X254 Mm

Sign In for Pricing
View Details
C2orf58 (NM_173652) Human Tagged ORF Clone Lentiviral Particle
RC206678L4V 200 µL

C2orf58 (NM_173652) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Prkx sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6410605 3x 1.0 µg

Prkx sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
CO040 Antibody
C43200-01 50 µL

CO040 Antibody

Sign In for Pricing
View Details