Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGOHB Antibody
GWB-MW639I 50 µg

MAGOHB Antibody

Sign In for Pricing
View Details
SIDT1-AS1 Adenovirus (Human)
43749051 1.0 mL

SIDT1-AS1 Adenovirus (Human)

Sign In for Pricing
View Details
C-Myc (c Myc, Cellular Myelocytomatosis Oncogene, Myc Protein, Myc Proto-oncogene Protein, Myc2, Niard, Nird, Transcription Factor p64, v-Myc Avian Myelocytomatosis Viral Oncogene Homolog (Avian) ) (PE) discontinued
C0035-03H-PE 100 µL

C-Myc (c Myc, Cellular Myelocytomatosis Oncogene, Myc Protein, Myc Proto-oncogene Protein, Myc2, Niard, Nird, Transcription Factor p64, v-Myc Avian Myelocytomatosis Viral Oncogene Homolog (Avian) ) (PE) discontinued

Sign In for Pricing
View Details
Signal Regulatory Protein Alpha (SIRPA) Antibody (HRP)
abx305309-01 20 µg

Signal Regulatory Protein Alpha (SIRPA) Antibody (HRP)

Sign In for Pricing
View Details
Signal Regulatory Protein Alpha (SIRPA) Antibody (HRP)
abx305309-02 50 µg

Signal Regulatory Protein Alpha (SIRPA) Antibody (HRP)

Sign In for Pricing
View Details
Signal Regulatory Protein Alpha (SIRPA) Antibody (HRP)
abx305309-03 100 µg

Signal Regulatory Protein Alpha (SIRPA) Antibody (HRP)

Sign In for Pricing
View Details