Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ER alpha/ESR1, Human (His)

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ER alpha/ESR1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html

Purity

97.00

Smiles

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

Molecular Formula

2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)

Molecular Weight

Approximately 12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP3CB (Serine/Threonine-Protein Phosphatase 2B Catalytic Subunit Beta Isoform, Protein Phosphatase 3, Catalytic Subunit, Beta Isoform)
489250 100 µL

PPP3CB (Serine/Threonine-Protein Phosphatase 2B Catalytic Subunit Beta Isoform, Protein Phosphatase 3, Catalytic Subunit, Beta Isoform)

Sign In for Pricing
View Details
Srsf4 (NM_001108685) Rat Tagged ORF Clone Lentiviral Particle
RR208460L4V 200 µL

Srsf4 (NM_001108685) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human ABLIM1 Protein - (Dry Ice)
H00003983-P01-10ug 10 µg

Recombinant Human ABLIM1 Protein - (Dry Ice)

Sign In for Pricing
View Details
Human CLDN9 full length protein-synthetic nanodisc
MBS189838-01 0.01 mg

Human CLDN9 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human CLDN9 full length protein-synthetic nanodisc
MBS189838-02 0.05 mg

Human CLDN9 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human CLDN9 full length protein-synthetic nanodisc
MBS189838-03 0.1 mg

Human CLDN9 full length protein-synthetic nanodisc

Sign In for Pricing
View Details