ER alpha/ESR1, Human (His)
The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
ER alpha/ESR1 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/er-alpha-protein-human-his.html
Purity
97.00
Smiles
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ
Molecular Formula
2099 (Gene_ID) P03372-1 (M1-Q116) (Accession)
Molecular Weight
Approximately 12-14 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
C16 Ganglioside GM2-d9 (d18:1/16:0-d9) (ammonium salt)
Lentiviral mouse 1700066B19Rik shRNA (UAS) - Lentiviral mouse 1700066B19Rik shRNA (UAS) (100)
Macrophage Scavenger Receptor Type I (MSR1, CD204, Macrophage Acetylated LDL Receptor I and II, Macrophage Scavenger Receptor Types I and II, phSR1, Scavenger Receptor Class A Member 1, SCARA1, Scavenger Receptor Type A, SRA, Scvr) (AP)
