Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitf ORF Vector (Mouse) (pORF)
ORF050243 1.0 µg DNA

Mitf ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal Serpin A3/alpha 1-Antichymotrypsin Antibody (AACT/1452) [Alexa Fluor 594]
NBP2-54438AF594 0.1 mL

Mouse Monoclonal Serpin A3/alpha 1-Antichymotrypsin Antibody (AACT/1452) [Alexa Fluor 594]

Sign In for Pricing
View Details
TAZ Protein Vector (Mouse) (pPB-N-His)
PV236579 500 ng

TAZ Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
DYRK1B Antibody
E38PA5164 100 µL

DYRK1B Antibody

Sign In for Pricing
View Details
TLN1, Recombinant, Human, aa92-399, GST-Tag (Talin-1)
375587-01 20 µg

TLN1, Recombinant, Human, aa92-399, GST-Tag (Talin-1)

Sign In for Pricing
View Details
TLN1, Recombinant, Human, aa92-399, GST-Tag (Talin-1)
375587-02 100 µg

TLN1, Recombinant, Human, aa92-399, GST-Tag (Talin-1)

Sign In for Pricing
View Details