Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prmt8 (NM_201371) Mouse Tagged Lenti ORF Clone
MR205920L3 10 µg

Prmt8 (NM_201371) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
C14orf2 (ATP5MPL) (NM_004894) Human Tagged ORF Clone Lentiviral Particle
RC201346L4V 200 µL

C14orf2 (ATP5MPL) (NM_004894) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CLEC9A Protein Vector (Mouse) (pPM-C-His)
PV166245 500 ng

CLEC9A Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
CFI Protein Vector (Rat) (pPB-C-His)
PV259622 500 ng

CFI Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Magnesium Chloride Hexahydrate AR/ACS
113120 500 500 g

Magnesium Chloride Hexahydrate AR/ACS

Sign In for Pricing
View Details
Ascl1 (NM_008553) Mouse Tagged ORF Clone
MR227072 10 µg

Ascl1 (NM_008553) Mouse Tagged ORF Clone

Sign In for Pricing
View Details