Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCN Protein Vector (Rat) (pPM-C-His)
PV263297 500 ng

DCN Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
1- (6-bromo-7-fluoro-1-methyl-1H-indazol-3-yl) -1,3-diazinane-2,4-dione
JH917191 1 Each

1- (6-bromo-7-fluoro-1-methyl-1H-indazol-3-yl) -1,3-diazinane-2,4-dione

Sign In for Pricing
View Details
Anti E. coli OmpF Pab
111355 100 µg

Anti E. coli OmpF Pab

Sign In for Pricing
View Details
Pick1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6944102 1.0 µg DNA

Pick1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Psmb6 AAV siRNA Pooled Vector
37962166 1.0 µg

Psmb6 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
pLV3-CMV-PML-Myc-EF1a-Puro Plasmid
PVT44894 2 µg

pLV3-CMV-PML-Myc-EF1a-Puro Plasmid

Sign In for Pricing
View Details