Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VN1R23P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV755684 1.0 µg DNA

VN1R23P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
PDXDC1 (NM_015027) Human 3' UTR Clone
SC214620 10 µg

PDXDC1 (NM_015027) Human 3' UTR Clone

Sign In for Pricing
View Details
SECTM1 Human Recombinant Protein
TP721359 25 µg

SECTM1 Human Recombinant Protein

Sign In for Pricing
View Details
Cellular Tumor Antigen p53 Phospho-Ser392 (TP53 pS392) Antibody
abx139925 0.1 mg

Cellular Tumor Antigen p53 Phospho-Ser392 (TP53 pS392) Antibody

Sign In for Pricing
View Details
CDKN2A Polyclonal Antibody
ANT-11440-100ug 100 µg

CDKN2A Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-HSP70 (Tyr41) Polyclonal Antibody, PE Conjugated
bs-5362R-PE 100 µL

Phospho-HSP70 (Tyr41) Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details