Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE4A, NT (PDE4A, DPDE2, cAMP-specific 3',5'-cyclic phosphodiesterase 4A, PDE46) (Azide free) (HRP) discontinued
039802-HRP 200 µL

PDE4A, NT (PDE4A, DPDE2, cAMP-specific 3',5'-cyclic phosphodiesterase 4A, PDE46) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
CFAP298 (NM_021254) Human Untagged Clone
SC319422 10 µg

CFAP298 (NM_021254) Human Untagged Clone

Sign In for Pricing
View Details
Uqcrh sgRNA CRISPR Lentivector set (Rat)
K7167701 3x 1.0 µg

Uqcrh sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
EHD1 Blocking Peptide
MBS9627172-01 1 mg

EHD1 Blocking Peptide

Sign In for Pricing
View Details
EHD1 Blocking Peptide
MBS9627172-02 5x 1 mg

EHD1 Blocking Peptide

Sign In for Pricing
View Details
Acyl-CoA Thioesterase 9 (ACOT9) Antibody
abx213417-01 50 µL

Acyl-CoA Thioesterase 9 (ACOT9) Antibody

Sign In for Pricing
View Details