Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Natural Killer Cell Receptor Nkg2A (KLRC1) Protein
abx693181 50 µg

Mouse Natural Killer Cell Receptor Nkg2A (KLRC1) Protein

Sign In for Pricing
View Details
HAVCR1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61788R-BF750 100 µL

HAVCR1 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
SLC5A1, CT (SGLT1, High Affinity Sodium Glucose Cotransporter 1, High Affinity Sodium Glucose Cotransporter, High Affinity Sodium-glucose Cotransporter, Human Na+/glucose Cotransporter 1, Na (+) /glucose Cotransporter 1, Na+/glucose Cotransporter 1, NAGT, SC5A1_HUMAN, SGLT 1, Sodium Glucose Cotransporter 1, Sodium/Glucose Cotransporter 1, Solute Carrier Family 5 (Sodium/Glucose Cotransporter) Member 1, Solute Carrier Family 5 Member 1)
303613 100 µg

SLC5A1, CT (SGLT1, High Affinity Sodium Glucose Cotransporter 1, High Affinity Sodium Glucose Cotransporter, High Affinity Sodium-glucose Cotransporter, Human Na+/glucose Cotransporter 1, Na (+) /glucose Cotransporter 1, Na+/glucose Cotransporter 1, NAGT, SC5A1_HUMAN, SGLT 1, Sodium Glucose Cotransporter 1, Sodium/Glucose Cotransporter 1, Solute Carrier Family 5 (Sodium/Glucose Cotransporter) Member 1, Solute Carrier Family 5 Member 1)

Sign In for Pricing
View Details
Elf1 ORF Vector (Mouse) (pORF)
ORF043826 1.0 µg DNA

Elf1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Vials, 2ml with cap (500 pack)
10832 500/Bag

Vials, 2ml with cap (500 pack)

Sign In for Pricing
View Details
Git2 (NM_001077359) Mouse Tagged ORF Clone Lentiviral Particle
MR221937L3V 200 µL

Git2 (NM_001077359) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details