Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galectin 3 (LGALS3) Mouse Monoclonal Antibody [Clone ID: OTI15E4]
TA804697S 30 µL

Galectin 3 (LGALS3) Mouse Monoclonal Antibody [Clone ID: OTI15E4]

Sign In for Pricing
View Details
Chicken S100A11 ELISA Kit
ECKS0027 96 Tests

Chicken S100A11 ELISA Kit

Sign In for Pricing
View Details
Mucin 1 (MUC1 Glycoprotein, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, CD227, EMA, Episialin, H23AG, KL-6, MAM6, MUC-1, MUC-1/SEC, MUC-1/X, MUC1/ZD, Mucin-1, Peanut-reactive urinary mucin, PEM, PEMT, Polymorphic epithelial mucin,
MBS6269020-01 0.1 mL

Mucin 1 (MUC1 Glycoprotein, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, CD227, EMA, Episialin, H23AG, KL-6, MAM6, MUC-1, MUC-1/SEC, MUC-1/X, MUC1/ZD, Mucin-1, Peanut-reactive urinary mucin, PEM, PEMT, Polymorphic epithelial mucin,

Sign In for Pricing
View Details
Mucin 1 (MUC1 Glycoprotein, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, CD227, EMA, Episialin, H23AG, KL-6, MAM6, MUC-1, MUC-1/SEC, MUC-1/X, MUC1/ZD, Mucin-1, Peanut-reactive urinary mucin, PEM, PEMT, Polymorphic epithelial mucin,
MBS6269020-02 5x 0.1 mL

Mucin 1 (MUC1 Glycoprotein, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, CD227, EMA, Episialin, H23AG, KL-6, MAM6, MUC-1, MUC-1/SEC, MUC-1/X, MUC1/ZD, Mucin-1, Peanut-reactive urinary mucin, PEM, PEMT, Polymorphic epithelial mucin,

Sign In for Pricing
View Details
Mouse Cytidine deaminase, CDA GENLISA ELISA
KLM1991 96 Well

Mouse Cytidine deaminase, CDA GENLISA ELISA

Sign In for Pricing
View Details
Olig1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4671505 3x 1.0 µg

Olig1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details