Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Poldip3 3'UTR GFP Stable Cell Line
TU266510 1.0 mL

Poldip3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human BLTP3A qPCR Primer Pair
QH43385S 200 Tests

Human BLTP3A qPCR Primer Pair

Sign In for Pricing
View Details
Rabbit Polyclonal MRPL32 Antibody
NBP2-13615-25ul 25 µL

Rabbit Polyclonal MRPL32 Antibody

Sign In for Pricing
View Details
Tubulin polymerization-IN-52
MBS5821427 Inquire

Tubulin polymerization-IN-52

Sign In for Pricing
View Details
Rabbit Anti-Chicken IgY Fab
MBS9148780-01 0.1 mL

Rabbit Anti-Chicken IgY Fab

Sign In for Pricing
View Details
Rabbit Anti-Chicken IgY Fab
MBS9148780-02 5x 0.1 mL

Rabbit Anti-Chicken IgY Fab

Sign In for Pricing
View Details