Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP3A5P1 siRNA Oligos set (Human)
56150171 3x 5 nmol

CYP3A5P1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
PREPL Polyclonal Antibody
MBS9432114-01 0.05 mL

PREPL Polyclonal Antibody

Sign In for Pricing
View Details
PREPL Polyclonal Antibody
MBS9432114-02 0.1 mL

PREPL Polyclonal Antibody

Sign In for Pricing
View Details
PREPL Polyclonal Antibody
MBS9432114-03 5x 0.1 mL

PREPL Polyclonal Antibody

Sign In for Pricing
View Details
Enpp1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7004402 1.0 µg DNA

Enpp1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Human KLF2 qPCR Primer Pair
QH31265S 200 Tests

Human KLF2 qPCR Primer Pair

Sign In for Pricing
View Details