Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EBI3 Antibody, Biotin conjugated
A20106-100UG 100 µg

EBI3 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Human RPS6KA1 shRNA Plasmid
abx954170-01 150 µg

Human RPS6KA1 shRNA Plasmid

Sign In for Pricing
View Details
Human RPS6KA1 shRNA Plasmid
abx954170-02 300 µg

Human RPS6KA1 shRNA Plasmid

Sign In for Pricing
View Details
Rabbit anti-SPATA2 IHC Antibody, Affinity Purified
IHC-00734 25 µg

Rabbit anti-SPATA2 IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
PAK1 / 2 / 3 (pS144 / 141 / 139) Blocking Peptide
abx161696-01 1 mg

PAK1 / 2 / 3 (pS144 / 141 / 139) Blocking Peptide

Sign In for Pricing
View Details
PAK1 / 2 / 3 (pS144 / 141 / 139) Blocking Peptide
abx161696-02 5 mg

PAK1 / 2 / 3 (pS144 / 141 / 139) Blocking Peptide

Sign In for Pricing
View Details