Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tram2 (NM_133252) Mouse Tagged Lenti ORF Clone
MR205718L4 10 µg

Tram2 (NM_133252) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
FLJ14213 (PRR5L) (NM_001160169) Human Over-expression Lysate
LH01154V 100 µg

FLJ14213 (PRR5L) (NM_001160169) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat UBE2D1 siRNA
abx938759-01 15 nmol

Rat UBE2D1 siRNA

Sign In for Pricing
View Details
Rat UBE2D1 siRNA
abx938759-02 30 nmol

Rat UBE2D1 siRNA

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD45.2 Antibody[104.2]
E-AB-F11220-01 25 µg

AF/LE Purified Anti-Mouse CD45.2 Antibody[104.2]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD45.2 Antibody[104.2]
E-AB-F11220-02 100 µg

AF/LE Purified Anti-Mouse CD45.2 Antibody[104.2]

Sign In for Pricing
View Details