Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Heat Shock Protein Family B (Small) Member 1 (HSPB1) ELISA Kit-Sandwich
EK9F856-01 48 Test

Porcine Heat Shock Protein Family B (Small) Member 1 (HSPB1) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Porcine Heat Shock Protein Family B (Small) Member 1 (HSPB1) ELISA Kit-Sandwich
EK9F856-02 96 Tests

Porcine Heat Shock Protein Family B (Small) Member 1 (HSPB1) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Fish Sialophorin (SPN) ELISA Kit
MBS9923775 Inquire

Fish Sialophorin (SPN) ELISA Kit

Sign In for Pricing
View Details
CNPPD1 Recombinant Protein (Rat)
RP195653 100 µg

CNPPD1 Recombinant Protein (Rat)

Sign In for Pricing
View Details
CD142 (CD142 Antigen, Coagulation Factor III, F3, Tissue Factor, TF, TFA, Thromboplastin) (HRP)
MBS6250422-01 0.1 mL

CD142 (CD142 Antigen, Coagulation Factor III, F3, Tissue Factor, TF, TFA, Thromboplastin) (HRP)

Sign In for Pricing
View Details
CD142 (CD142 Antigen, Coagulation Factor III, F3, Tissue Factor, TF, TFA, Thromboplastin) (HRP)
MBS6250422-02 5x 0.1 mL

CD142 (CD142 Antigen, Coagulation Factor III, F3, Tissue Factor, TF, TFA, Thromboplastin) (HRP)

Sign In for Pricing
View Details