Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HBA1 shRNA Plasmid
abx952067-01 150 µg

Human HBA1 shRNA Plasmid

Sign In for Pricing
View Details
Human HBA1 shRNA Plasmid
abx952067-02 300 µg

Human HBA1 shRNA Plasmid

Sign In for Pricing
View Details
RPL7P47 CRISPR Knock Out 293T Cell Line (Human)
41908141 1x 10^6 Cells / 1.0 mL

RPL7P47 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Human KLK8 ELISA Kit
EHK0082 96 Tests

Human KLK8 ELISA Kit

Sign In for Pricing
View Details
Lamin B2 (APC)
L1220-35-APC 100 µL

Lamin B2 (APC)

Sign In for Pricing
View Details
CD79A, CT (CD79A, IGA, MB1, B Cell antigen receptor complex-associated protein alpha chain, Ig-alpha, MB-1 membrane glycoprotein, Membrane-bound immunoglobulin-associated protein, Surface IgM-associated protein, CD_antigen=CD79a) (Biotin) discontinued
030862-Biotin 200 µL

CD79A, CT (CD79A, IGA, MB1, B Cell antigen receptor complex-associated protein alpha chain, Ig-alpha, MB-1 membrane glycoprotein, Membrane-bound immunoglobulin-associated protein, Surface IgM-associated protein, CD_antigen=CD79a) (Biotin) discontinued

Sign In for Pricing
View Details