Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cort Mouse shRNA Lentiviral Particle (Locus ID 12854)
TL518937V 500 µL Each

Cort Mouse shRNA Lentiviral Particle (Locus ID 12854)

Sign In for Pricing
View Details
Human SF20/IL-25 Recombinant Protein
PROTQ969H8-100ug 100 µg

Human SF20/IL-25 Recombinant Protein

Sign In for Pricing
View Details
TOP2B Protein Vector (Human) (pPM-C-His)
PV136629 500 ng

TOP2B Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CEP76 Polyclonal Antibody
UB-GEN-3681 100 µL

CEP76 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Ddx31 shRNA (UAS) - Lentiviral mouse Ddx31 shRNA (UAS, GFP) plasmid
GTR15182734 1 Vial

Lentiviral mouse Ddx31 shRNA (UAS) - Lentiviral mouse Ddx31 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Recombinant Rat TEX29 Protein, His (Fc)-Avi-tagged
TEX29-5681R 50 µg

Recombinant Rat TEX29 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details