Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NTRK2 (Neurotrophic Tyrosine Kinase Receptor Type 2) BioAssayTM ELISA Kit (Mouse) discontinued
357745-01 48 Tests

NTRK2 (Neurotrophic Tyrosine Kinase Receptor Type 2) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
NTRK2 (Neurotrophic Tyrosine Kinase Receptor Type 2) BioAssayTM ELISA Kit (Mouse) discontinued
357745-02 96 Tests

NTRK2 (Neurotrophic Tyrosine Kinase Receptor Type 2) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
Valyl tRNA Synthetase
550572 200 µL

Valyl tRNA Synthetase

Sign In for Pricing
View Details
Rat Chrd ELISA Kit
ELI-10646r 96 Tests

Rat Chrd ELISA Kit

Sign In for Pricing
View Details
1.3-Dihydroxycarbonyl-2-amino-azulene
91493-47-9 1 Each

1.3-Dihydroxycarbonyl-2-amino-azulene

Sign In for Pricing
View Details
Paeoniflorin (>80%)
TRC-P133830-50MG 50 mg

Paeoniflorin (>80%)

Sign In for Pricing
View Details