Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Mouse Apolipoprotein M (APOM) Polyclonal Antibody
VD2N956 1 Each

Rabbit Anti-Mouse Apolipoprotein M (APOM) Polyclonal Antibody

Sign In for Pricing
View Details
TSG6 (TNFAIP6) Rabbit Polyclonal Antibody
TA358505 100 µL

TSG6 (TNFAIP6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Serpinf2 (NM_008878) Mouse Tagged Lenti ORF Clone
MR220102L4 10 µg

Serpinf2 (NM_008878) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Calcipressin 3, CT (Regulator of Calcineurin 3, Down Syndrome Candidate Region 1-like Protein 2, Myocyte-enriched Calcineurin Interacting Protein 3, MCIP3, DSCR1L2, RCAN3) (MaxLight 650) discontinued
C0114-87A-ML650 100 µL

Calcipressin 3, CT (Regulator of Calcineurin 3, Down Syndrome Candidate Region 1-like Protein 2, Myocyte-enriched Calcineurin Interacting Protein 3, MCIP3, DSCR1L2, RCAN3) (MaxLight 650) discontinued

Sign In for Pricing
View Details
ZNF498, ID (ZNF498, ZSCAN25, Zinc finger protein 498, Zinc finger and SCAN domain-containing protein 25)
044254 200 µL

ZNF498, ID (ZNF498, ZSCAN25, Zinc finger protein 498, Zinc finger and SCAN domain-containing protein 25)

Sign In for Pricing
View Details
6-Chloro-pyrimidine-2,4-diamine 3-Oxide (Minoxidil EP Impurity A)
006704-01 100 mg

6-Chloro-pyrimidine-2,4-diamine 3-Oxide (Minoxidil EP Impurity A)

Sign In for Pricing
View Details