Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 6 Receptor, gp80, endotoxin-free (CD126, IL-6R) (MaxLight 550)
MBS6259495-01 0.1 mL

Interleukin 6 Receptor, gp80, endotoxin-free (CD126, IL-6R) (MaxLight 550)

Sign In for Pricing
View Details
Interleukin 6 Receptor, gp80, endotoxin-free (CD126, IL-6R) (MaxLight 550)
MBS6259495-02 5x 0.1 mL

Interleukin 6 Receptor, gp80, endotoxin-free (CD126, IL-6R) (MaxLight 550)

Sign In for Pricing
View Details
Mouse Zbtb42 Pre-designed siRNA Set A
SI116244A 1 Each

Mouse Zbtb42 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Cpeb3 3'UTR Luciferase Stable Cell Line
TU104293 1.0 mL

Cpeb3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Abce1 shRNA (UAS) - Lentiviral mouse Abce1 shRNA (UAS, GFP) plasmid
GTR15213214 1 Vial

Lentiviral mouse Abce1 shRNA (UAS) - Lentiviral mouse Abce1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Sp4 (NM_001166385) Mouse Tagged Lenti ORF Clone
MR210624L4 10 µg

Sp4 (NM_001166385) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details