Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant S. cerevisiae GTP-binding nuclear protein/ CNR1 Protein, His, Yeast-200ug
QP7163-ye-200ug 200ug

Recombinant S. cerevisiae GTP-binding nuclear protein/ CNR1 Protein, His, Yeast-200ug

Sign In for Pricing
View Details
PCNP CRISPR Activation Plasmid (m2)
sc-429298-ACT-2 20 µg

PCNP CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Rat FAF2 shRNA Plasmid
abx988480-01 150 µg

Rat FAF2 shRNA Plasmid

Sign In for Pricing
View Details
Rat FAF2 shRNA Plasmid
abx988480-02 300 µg

Rat FAF2 shRNA Plasmid

Sign In for Pricing
View Details
Mouse Monoclonal RBM46 Antibody (OTI1D6) [PerCP]
NBP2-73833PCP 0.1 mL

Mouse Monoclonal RBM46 Antibody (OTI1D6) [PerCP]

Sign In for Pricing
View Details
DNAJB9, NT (DNAJB9, MDG1, DnaJ homolog subfamily B member 9, Microvascular endothelial differentiation gene 1 protein) (APC)
MBS6292719-01 0.2 mL

DNAJB9, NT (DNAJB9, MDG1, DnaJ homolog subfamily B member 9, Microvascular endothelial differentiation gene 1 protein) (APC)

Sign In for Pricing
View Details