Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BUB3 Protein Vector (Human) (pPB-His-MBP)
PV327950 500 ng

BUB3 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
DEFA1 Over-expression Lysate Product
GWB-FED283 0.1 mg

DEFA1 Over-expression Lysate Product

Sign In for Pricing
View Details
Prickle2 (NM_001134459) Mouse Tagged ORF Clone
MG223810 10 µg

Prickle2 (NM_001134459) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Homeodomain-Only Protein (HOPX) Antibody
abx233970 100 µg

Homeodomain-Only Protein (HOPX) Antibody

Sign In for Pricing
View Details
1300001I01Rik sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3444804 1.0 µg DNA

1300001I01Rik sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Lentiviral human RSPO4 shRNA (UAS) - Lentiviral human RSPO4 shRNA (UAS, iRFP) (25)
GTR15351617 1 Vial

Lentiviral human RSPO4 shRNA (UAS) - Lentiviral human RSPO4 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details