Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYO18A Antibody, Biotin Conjugated
MBS7133782-01 0.05 mL

MYO18A Antibody, Biotin Conjugated

Sign In for Pricing
View Details
MYO18A Antibody, Biotin Conjugated
MBS7133782-02 0.1 mL

MYO18A Antibody, Biotin Conjugated

Sign In for Pricing
View Details
MYO18A Antibody, Biotin Conjugated
MBS7133782-03 5x 0.1 mL

MYO18A Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Recombinant Human VHL Protein, His, E.coli-50ug
QP13934-50ug 50ug

Recombinant Human VHL Protein, His, E.coli-50ug

Sign In for Pricing
View Details
RPL36P12 AAV Vector (Human) (CMV)
41590101 1 µg

RPL36P12 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Rat GCSFR (Colony Stimulating Factor Receptor, Granulocyte) ELISA Kit
ER0983 96 Tests

Rat GCSFR (Colony Stimulating Factor Receptor, Granulocyte) ELISA Kit

Sign In for Pricing
View Details