Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pnkd ORF Vector (Mouse) (pORF)
ORF054374 1.0 µg DNA

Pnkd ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ITIH4 (NM_002218) Human Recombinant Protein
TP319753M 100 µg

ITIH4 (NM_002218) Human Recombinant Protein

Sign In for Pricing
View Details
Disposable GL45 Transfer Cap for 500mL Plastic Spinner Flask 1/8inch Dip Tube 0.2?m Vent Male Luer
3565 2 / PCK

Disposable GL45 Transfer Cap for 500mL Plastic Spinner Flask 1/8inch Dip Tube 0.2?m Vent Male Luer

Sign In for Pricing
View Details
HES2 (Hairy and Enhancer of Split 2 (Drosophila), bHLHb40) (MaxLight 405)
MBS6195921-01 0.1 mL

HES2 (Hairy and Enhancer of Split 2 (Drosophila), bHLHb40) (MaxLight 405)

Sign In for Pricing
View Details
HES2 (Hairy and Enhancer of Split 2 (Drosophila), bHLHb40) (MaxLight 405)
MBS6195921-02 5x 0.1 mL

HES2 (Hairy and Enhancer of Split 2 (Drosophila), bHLHb40) (MaxLight 405)

Sign In for Pricing
View Details
Recombinant Human YEATS2 Protein, N-His
YHK96301 100 μg

Recombinant Human YEATS2 Protein, N-His

Sign In for Pricing
View Details