Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Photorhabdus luminescens subsp. laumondii Cation/acetate symporter ActP (actP), partial
MBS7088882 Inquire

Recombinant Photorhabdus luminescens subsp. laumondii Cation/acetate symporter ActP (actP), partial

Sign In for Pricing
View Details
YY1 shRNA Plasmid (h)
sc-36863-SH 20 µg

YY1 shRNA Plasmid (h)

Sign In for Pricing
View Details
Phospho-MEF2D (Ser444) Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-5502R-PerCP-Cy5.5 100 µL

Phospho-MEF2D (Ser444) Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
14-3-3 beta/alpha (14-3-3 Protein beta/alpha, Protein 1054, Protein Kinase C Inhibitor Protein 1, KCIP-1, YWHAB) discontinued
135487 100 µg

14-3-3 beta/alpha (14-3-3 Protein beta/alpha, Protein 1054, Protein Kinase C Inhibitor Protein 1, KCIP-1, YWHAB) discontinued

Sign In for Pricing
View Details
QuantiChrom™ Phytase Assay Kit
DPHT-100 100 Tests

QuantiChrom™ Phytase Assay Kit

Sign In for Pricing
View Details
Klkb1 (NM_008455) Mouse Recombinant Protein
TP509674 20 µg

Klkb1 (NM_008455) Mouse Recombinant Protein

Sign In for Pricing
View Details