Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom2r17 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6070905 3x 1.0 µg

Vom2r17 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Human MMP10 Protein, N-His
HY542012-01 50 µg

Recombinant Human MMP10 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MMP10 Protein, N-His
HY542012-02 100 µg

Recombinant Human MMP10 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MMP10 Protein, N-His
HY542012-03 1 mg

Recombinant Human MMP10 Protein, N-His

Sign In for Pricing
View Details
PCDH10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1602406 1.0 µg DNA

PCDH10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Phospho-Tau (Ser416) Polyclonal Antibody, Cy3 Conjugated
bs-5473R-Cy3 100 µL

Phospho-Tau (Ser416) Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details