Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trip11 3'UTR Lenti-reporter-Luc Vector
47856084 1.0 µg

Trip11 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
P53 Monoclonal Antibody, PerCP Conjugated
bsm-33058M-PerCP 100 µL

P53 Monoclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
ACTN1/ACTN2/ACTN3/ACTN4 Antibody
A43729-100UL 100 µL

ACTN1/ACTN2/ACTN3/ACTN4 Antibody

Sign In for Pricing
View Details
CDK5RAP3 (NM_176096) Human Tagged Lenti ORF Clone
RC209901L2 10 µg

CDK5RAP3 (NM_176096) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SVH (ARMC10) (NM_001161012) Human 3' UTR Clone
SC213160 10 µg

SVH (ARMC10) (NM_001161012) Human 3' UTR Clone

Sign In for Pricing
View Details
GPDS1 sgRNA CRISPR Lentivector set (Human)
K0887301 3x 1.0 µg

GPDS1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details