Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2082707 1.0 µg DNA

S100A6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
5,6-Monoepoxyretinyl Acetate-D5
sc-487486 0.5 mg

5,6-Monoepoxyretinyl Acetate-D5

Sign In for Pricing
View Details
Lentiviral human SSC4D shRNA (UAS) - Lentiviral human SSC4D shRNA (UAS) plasmid
GTR15334606 1 Vial

Lentiviral human SSC4D shRNA (UAS) - Lentiviral human SSC4D shRNA (UAS) plasmid

Sign In for Pricing
View Details
CTRP1 (C1QTNF1) (NM_198594) Human Tagged Lenti ORF Clone
RC205811L4 10 µg

CTRP1 (C1QTNF1) (NM_198594) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SHOC2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
43727061 1.0 µg DNA

SHOC2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TRNAQ44P-set siRNA/shRNA/RNAi Lentivector (Human)
48315091 4x 500 ng

TRNAQ44P-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details