Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1, Mouse (HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DLK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dlk-1-protein-mouse-hek293-his.html

Purity

95.00

Smiles

AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ

Molecular Formula

13386 (Gene_ID) Q09163-1 (A24-Q305) (Accession)

Molecular Weight

50-68 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNJ2 Recombinant Protein (Rat)
RP206846 100 µg

KCNJ2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
PECMV-Ddx4-m-FLAG
BZ15748 1 Vial

PECMV-Ddx4-m-FLAG

Sign In for Pricing
View Details
MERTK Immunizing Peptide
MBS428127-01 0.1 mg

MERTK Immunizing Peptide

Sign In for Pricing
View Details
MERTK Immunizing Peptide
MBS428127-02 5x 0.1 mg

MERTK Immunizing Peptide

Sign In for Pricing
View Details
Mouse Monoclonal Napsin A Antibody (NAPSA/1239) [DyLight 350]
NBP2-54384UV 100 µL

Mouse Monoclonal Napsin A Antibody (NAPSA/1239) [DyLight 350]

Sign In for Pricing
View Details
MIR3118-1 Human MicroRNA Expression Plasmid (MI0014131)
SC401304 10 µg

MIR3118-1 Human MicroRNA Expression Plasmid (MI0014131)

Sign In for Pricing
View Details