Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAM-1, Human (HEK293, Fc)

DNAM-1 protein is a key player in cell-cell adhesion and lymphocyte signaling, mediating cytotoxicity and lymphokine secretion of CTL and NK cells. As a receptor for NECTIN2, DNAM-1 stimulates T cell proliferation and cytokine production (IL2, IL5, IL10, IL13, and IFNG) upon ligand binding. DNAM-1 Protein, Human (HEK293, Fc) is the recombinant human-derived DNAM-1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

DNAM-1 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dnam-1-protein-human-hek-293-fc.html

Purity

95.0

Smiles

EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN

Molecular Formula

10666 (Gene_ID) Q15762 (E19-N247) (Accession)

Molecular Weight

72-90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF3 Polyclonal Antibody, Cy3 Conjugated
bs-1255R-Cy3 100 µL

FGF3 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
MYEOV Rabbit Polyclonal Antibody
E28PN0895 100 µL

MYEOV Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EST1A (SMG6) (NM_001256828) Human Tagged ORF Clone
RG232894 10 µg

EST1A (SMG6) (NM_001256828) Human Tagged ORF Clone

Sign In for Pricing
View Details
9-Phenyl-9H-3,9'-bicarbazole
JH913612 1 Each

9-Phenyl-9H-3,9'-bicarbazole

Sign In for Pricing
View Details
FCRL4 Rabbit Polyclonal Antibody (HRP)
orb2112293 100 µL

FCRL4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
DEFA1 (Neutrophil Defensin 1, Defensin, alpha 1, HNP-1, HP-1, HP1, DEF1, DEFA2, MRS, DEFA1B) (MaxLight 550)
MBS6211120-01 0.1 mL

DEFA1 (Neutrophil Defensin 1, Defensin, alpha 1, HNP-1, HP-1, HP1, DEF1, DEFA2, MRS, DEFA1B) (MaxLight 550)

Sign In for Pricing
View Details