Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyclophilin A, Mouse (His)

Cyclophilin A (PPIA) protein, with integrin binding and peptidyl-prolyl cis-trans isomerase activity, influences platelet aggregation and neuron differentiation. It is found in the extracellular space and myelin sheath, showing ubiquitous expression in various tissues, including the liver and central nervous system. PPIA is associated with cholangiocarcinoma and HIV disease, suggesting its role in fundamental cellular processes. Cyclophilin A Protein, Mouse (His) is the recombinant mouse-derived Cyclophilin A protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

Cyclophilin A Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cyclophilin-a-protein-mouse-his.html

Purity

98.0

Smiles

MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL

Molecular Formula

268373 (Gene_ID) P17742/NP_032933.1 (M1-L164) (Accession)

Molecular Weight

Approximately 18.94 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sample Concentrator BCON-108
BCON-108 1 Unit

Sample Concentrator BCON-108

Sign In for Pricing
View Details
Glucokinase (GCK) Human Gene Knockout Kit (CRISPR)
KN400472 1 Kit

Glucokinase (GCK) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD45RA (Leukocyte Marker) (K4B5), Biotin conjugate, 0.1mg/mL
BNCB1680-500 1x 500 µL

CD45RA (Leukocyte Marker) (K4B5), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RPL12 (NM_000976) Human Over-expression Lysate
LC424422 20 µg

RPL12 (NM_000976) Human Over-expression Lysate

Sign In for Pricing
View Details
PAX6 (PAX6/1166), CF568 conjugate, 0.1mg/mL
BNC681166-500 1x 500 µL

PAX6 (PAX6/1166), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Monkey CTSB (Cathepsin B) ELISA Kit
E-UNEL-MK0014-01 5x 96 Tests

Uncoated Monkey CTSB (Cathepsin B) ELISA Kit

Sign In for Pricing
View Details