Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyclophilin A, Mouse (His)

Cyclophilin A (PPIA) protein, with integrin binding and peptidyl-prolyl cis-trans isomerase activity, influences platelet aggregation and neuron differentiation. It is found in the extracellular space and myelin sheath, showing ubiquitous expression in various tissues, including the liver and central nervous system. PPIA is associated with cholangiocarcinoma and HIV disease, suggesting its role in fundamental cellular processes. Cyclophilin A Protein, Mouse (His) is the recombinant mouse-derived Cyclophilin A protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

Cyclophilin A Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cyclophilin-a-protein-mouse-his.html

Purity

98.0

Smiles

MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL

Molecular Formula

268373 (Gene_ID) P17742/NP_032933.1 (M1-L164) (Accession)

Molecular Weight

Approximately 18.94 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BubR1 (BUB1B) ELISA Kit 1 x 96
EA200061 96 Well

Human BubR1 (BUB1B) ELISA Kit 1 x 96

Sign In for Pricing
View Details
EGFR (GFR450), CF640R conjugate, 0.1mg/mL
BNC400450-500 1x 500 µL

EGFR (GFR450), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(E,Z)-4-(4-Chloro-1,2-diphenylbut-I-en-I-yl)phenol (1:1)
TRC-O703020-25MG 25 mg

(E,Z)-4-(4-Chloro-1,2-diphenylbut-I-en-I-yl)phenol (1:1)

Sign In for Pricing
View Details
Recombinant Rat Contactin 3/CNTN3 Protein (Fc Tag)
PKSR030240 100 µg

Recombinant Rat Contactin 3/CNTN3 Protein (Fc Tag)

Sign In for Pricing
View Details
Replacement Cartridge for Label Printers
L9010-12YK 1 Each

Replacement Cartridge for Label Printers

Sign In for Pricing
View Details
Rat Troponin I Type 3, Cardiac (TNNI3) ELISA Kit
RDR-TNNI3-Ra-01 96 Tests

Rat Troponin I Type 3, Cardiac (TNNI3) ELISA Kit

Sign In for Pricing
View Details