Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyclophilin A, Mouse (His)

Cyclophilin A (PPIA) protein, with integrin binding and peptidyl-prolyl cis-trans isomerase activity, influences platelet aggregation and neuron differentiation. It is found in the extracellular space and myelin sheath, showing ubiquitous expression in various tissues, including the liver and central nervous system. PPIA is associated with cholangiocarcinoma and HIV disease, suggesting its role in fundamental cellular processes. Cyclophilin A Protein, Mouse (His) is the recombinant mouse-derived Cyclophilin A protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

Cyclophilin A Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cyclophilin-a-protein-mouse-his.html

Purity

98.0

Smiles

MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL

Molecular Formula

268373 (Gene_ID) P17742/NP_032933.1 (M1-L164) (Accession)

Molecular Weight

Approximately 18.94 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-Dithiouridine
TRC-D494370-25MG 25 mg

2,4-Dithiouridine

Sign In for Pricing
View Details
FHL2 (NM_001450) Human Over-expression Lysate
LY419930 100 µg

FHL2 (NM_001450) Human Over-expression Lysate

Sign In for Pricing
View Details
Primer Panel
HPP6009C 20x 96 Pre-Arrayed Plates

Primer Panel

Sign In for Pricing
View Details
Recombinant Human SERPINB1/PI2 Protein (Human Cells, His Tag)
PKSH032695-01 10 µg

Recombinant Human SERPINB1/PI2 Protein (Human Cells, His Tag)

Sign In for Pricing
View Details
Recombinant Human SERPINB1/PI2 Protein (Human Cells, His Tag)
PKSH032695-02 50 µg

Recombinant Human SERPINB1/PI2 Protein (Human Cells, His Tag)

Sign In for Pricing
View Details
Ribonuclease A (RNASE1) Human Gene Knockout Kit (CRISPR)
KN402755 1 Kit

Ribonuclease A (RNASE1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details