Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G2D, Human (His-SUMO)

PLA2G2D protein is a secreted calcium-dependent phospholipase A2 that targets extracellular lipids and has anti-inflammatory and immunosuppressive functions.It hydrolyzes the fatty acyl group at the sn-2 position, preferentially hydrolyzing phosphatidylethanolamine and phosphatidylglycerol.PLA2G2D Protein, Human (His-SUMO) is the recombinant human-derived PLA2G2D protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

PLA2G2D Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pla2g2d-protein-human-his-sumo.html

Purity

96.00

Smiles

ILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC

Molecular Formula

26279 (Gene_ID) Q9UNK4 (I22-C145) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HGF (HGF, HPTA, Hepatocyte growth factor, Hepatopoietin-A, Scatter factor, Hepatocyte growth factor alpha chain, Hepatocyte growth factor beta chain) (FITC)
MBS6121360-01 0.2 mL

HGF (HGF, HPTA, Hepatocyte growth factor, Hepatopoietin-A, Scatter factor, Hepatocyte growth factor alpha chain, Hepatocyte growth factor beta chain) (FITC)

Ask
View Details
HGF (HGF, HPTA, Hepatocyte growth factor, Hepatopoietin-A, Scatter factor, Hepatocyte growth factor alpha chain, Hepatocyte growth factor beta chain) (FITC)
MBS6121360-02 5x 0.2 mL

HGF (HGF, HPTA, Hepatocyte growth factor, Hepatopoietin-A, Scatter factor, Hepatocyte growth factor alpha chain, Hepatocyte growth factor beta chain) (FITC)

Ask
View Details
Recombinant Microtubule Associated Protein 4 (MAP4)
MBS2029991-01 0.01 mg

Recombinant Microtubule Associated Protein 4 (MAP4)

Ask
View Details
Recombinant Microtubule Associated Protein 4 (MAP4)
MBS2029991-02 0.05 mg

Recombinant Microtubule Associated Protein 4 (MAP4)

Ask
View Details
Recombinant Microtubule Associated Protein 4 (MAP4)
MBS2029991-03 0.1 mg

Recombinant Microtubule Associated Protein 4 (MAP4)

Ask
View Details
Recombinant Microtubule Associated Protein 4 (MAP4)
MBS2029991-04 0.2 mg

Recombinant Microtubule Associated Protein 4 (MAP4)

Ask
View Details