Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neurotrophin-4, Human

NT-4 Protein, Human is a member of neurotrophins family, binding with two distinct receptors: TrkB, high affinity receptor and p75 low-affinity neurotrophin receptor (p75NTR) .

Product Specifications

Product Name Alternative

Neurotrophin-4 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/nt-4-protein-human.html

Purity

98.0

Smiles

MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA

Molecular Formula

4909 (Gene_ID) P34130 (G81-A210) (Accession)

Molecular Weight

Approximately 26 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]D'Angelo L, et al. Neurotrophin-4 in the brain of adult Nothobranchius furzeri. Ann Anat. 2016 Sep;207:47-54.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G gamma12 (GNG12) Human Over-expression Lysate
orb1370030 20 µg

G gamma12 (GNG12) Human Over-expression Lysate

Sign In for Pricing
View Details
Myelin Oligodendrocyte Glycoprotein
rAP-3664 1 Each

Myelin Oligodendrocyte Glycoprotein

Sign In for Pricing
View Details
CCDC7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0373007 1.0 µg DNA

CCDC7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
MIRacle™ mmu-miR-494-5p miRNA Agomir/Antagomir
AM3542 2 OD, 4 OD, 50 OD

MIRacle™ mmu-miR-494-5p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
Mouse Anti-Chicken Ovalbumin Monoclonal Antibody
VD9N31 1 Each

Mouse Anti-Chicken Ovalbumin Monoclonal Antibody

Sign In for Pricing
View Details
DNA Polymerase epsilon Rabbit pAb, PerCP-Cy7 conjugated
orb2865822 100 µL

DNA Polymerase epsilon Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details