Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hantaan virus Envelopment polyprotein (GP), partial

Product Specifications

Product Name Alternative

(Glycoprotein precursor) (M polyprotein)

Abbreviation

Recombinant Hantaan virus GP protein, partial

Gene Name

GP

UniProt

P08668

Expression Region

649-1105aa

Organism

Hantaan virus (strain 76-118) (Korean hemorrhagic fever virus)

Target Sequence

SETPLTPVWNDNAHGVGSVPMHTDLELDFSLTSSSKYTYRRKLTNPLEEAQSIDLHIEIEEQTIGVDVHALGHWFDGRLNLKTSFHCYGACTKYEYPWHTAKCHYERDYQYETSWGCNPSDCPGVGTGCTACGLYLDQLKPVGSAYKIITIRYSRRVCVQFGEENLCKIIDMNDCFVSRHVKVCIIGTVSKFSQGDTLLFFGPLEGGGLIFKHWCTSTCQFGDPGDIMSPRDKGFLCPEFPGSFRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQSFNTSTMHFTDERIEWKDPDGMLRDHINILVTKDIDFDNLGENPCKIGLQTSSIEGAWGSGVGFTLTCLVSLTECPTFLTSIKACDKAICYGAESVTLTRGQNTVKVSGKGGHSGSTFRCCHGEDCSQIGLHAAAPHLDKVNGISEIENSKVYDDGAPQCGIKCWFVKSGEWISGIFSGN

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Others

Relevance

[Glycoprotein N]: Forms homotetramers with glycoprotein C at the surface of the virion. Attaches the virion to host cell receptors including integrin beta3/ITGB3 . This attachment induces virion internalization predominantly through clathrin-dependent endocytosis . Also promotes fusion of viral membrane with host endosomal membrane after endocytosis of the virion. May dysregulate normal immune and endothelial cell responses through an ITAM motif.; [Glycoprotein C]: Forms homotetramers with glycoprotein N at the surface of the virion. Attaches the virion to host cell receptors including integrin beta3/ITGB3 . This attachment induces virion internalization predominantly through clathrin-dependent endocytosis . Also promotes fusion of viral membrane with host endosomal membrane after endocytosis of the virion.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

56.1 kDa

References & Citations

"Cell fusion activities of Hantaan virus envelope glycoproteins." Ogino M., Yoshimatsu K., Ebihara H., Araki K., Lee B.H., Okumura M., Arikawa J. J. Virol. 78:10776-10782 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMG6 cDNA Clone
MBS1275633-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

SMG6 cDNA Clone

Sign In for Pricing
View Details
SMG6 cDNA Clone
MBS1275633-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

SMG6 cDNA Clone

Sign In for Pricing
View Details
Chicken N-Acetylneuraminic Acid Synthase ELISA Kit
MBS069104 Inquire

Chicken N-Acetylneuraminic Acid Synthase ELISA Kit

Sign In for Pricing
View Details
Zfp507 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV639121 1.0 µg DNA

Zfp507 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CD106 (CD106 Antigen, DKFZp779G2333, INCAM 100, INCAM-100, L1CAM, MGC99561, Vascular Cell Adhesion Molecule 1, VCAM 1, VCAM1, VCAM-1, Vascular Cell Adhesion Protein 1) (FITC)
C2447-02J-FITC 100 µL

CD106 (CD106 Antigen, DKFZp779G2333, INCAM 100, INCAM-100, L1CAM, MGC99561, Vascular Cell Adhesion Molecule 1, VCAM 1, VCAM1, VCAM-1, Vascular Cell Adhesion Protein 1) (FITC)

Sign In for Pricing
View Details
C14orf183 (LINC01599) (NM_001014830) Human Tagged Lenti ORF Clone
RC214759L3 10 µg

C14orf183 (LINC01599) (NM_001014830) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details