Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (102a.a, His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (102a.a, His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with N-His, N-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (102a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-102a-a-his.html

Purity

95.0

Smiles

KGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKD

Molecular Formula

3146 (Gene_ID) P09429 (K57-D158) (Accession)

Molecular Weight

Approximately 15 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse C-C Chemokine Receptor Type 4 (CCR4) ELISA Kit
abx518833 96 Tests

Mouse C-C Chemokine Receptor Type 4 (CCR4) ELISA Kit

Sign In for Pricing
View Details
PRK2 (C-6) : m-IgGκ BP-HRP Bundle
sc-534988 1 Kit

PRK2 (C-6) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Growth Hormone/GH1 Rabbit Polyclonal Antibody (Fluoro647)
orb3074696 100 µg

Growth Hormone/GH1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Thpo Antibody, FITC conjugated
CSB-PA07649C0Rb-01 50 µg

Thpo Antibody, FITC conjugated

Sign In for Pricing
View Details
Thpo Antibody, FITC conjugated
CSB-PA07649C0Rb-02 100 µg

Thpo Antibody, FITC conjugated

Sign In for Pricing
View Details
Eme2 (NM_001163102) Mouse Tagged ORF Clone Lentiviral Particle
MR215869L3V 200 µL

Eme2 (NM_001163102) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details