Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Caspase-12 (Casp12), partial

Product Specifications

Product Name Alternative

Caspase-12 (CASP-12) (EC 3.4.22.-)

Abbreviation

Recombinant Mouse Casp12 protein, partial

Gene Name

Casp12

UniProt

O08736

Expression Region

1-92aa

Organism

Mus musculus (Mouse)

Target Sequence

MAARRTHERDPIYKIKGLAKDMLDGVFDDLVEKNVLNGDELLKIGESASFILNKAENLVENFLEKTDMAGKIFAGHIANSQEQLSLQFSNDE

Tag

N-terminal 6xHis-B2M-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Involved in the activation cascade of caspases responsible for apoptosis execution.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.3 kDa

References & Citations

"Activation of caspase-12, an endoplastic reticulum (ER) resident caspase, through tumor necrosis factor receptor-associated factor 2-dependent mechanism in response to the ER stress." Yoneda T., Imaizumi K., Oono K., Yui D., Gomi F., Katayama T., Tohyama M. J. Biol. Chem. 276:13935-13940 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MRP1 (Multidrug Resistance Associated Protein 1) CLIA Kit
E-CL-H1220-01 24 Tests

Human MRP1 (Multidrug Resistance Associated Protein 1) CLIA Kit

Sign In for Pricing
View Details
Human MRP1 (Multidrug Resistance Associated Protein 1) CLIA Kit
E-CL-H1220-02 48 Tests

Human MRP1 (Multidrug Resistance Associated Protein 1) CLIA Kit

Sign In for Pricing
View Details
Human MRP1 (Multidrug Resistance Associated Protein 1) CLIA Kit
E-CL-H1220-03 96 Tests

Human MRP1 (Multidrug Resistance Associated Protein 1) CLIA Kit

Sign In for Pricing
View Details
SKA1 (NM_001039535) Human Over-expression Lysate
LY422066 100 µg

SKA1 (NM_001039535) Human Over-expression Lysate

Sign In for Pricing
View Details
JM4 (PRAF2) (NM_007213) Human Over-expression Lysate
LC402110 20 µg

JM4 (PRAF2) (NM_007213) Human Over-expression Lysate

Sign In for Pricing
View Details
(R)-1-Tosyloxy-2,3-propanediol-d2
TRC-T685502-5MG 5 mg

(R)-1-Tosyloxy-2,3-propanediol-d2

Sign In for Pricing
View Details