Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF6, Mouse (HEK293, His)

SLAMF6 protein is a self-ligand receptor in the SLAM family, which complexly regulates the activation and differentiation of immune cells through homotypic or heterotypic interactions, affecting innate and adaptive immune responses. It relies on cytoplasmic adapters such as SH2D1A/SAP and/or SH2D1B/EAT-2 for activity control. SLAMF6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SLAMF6 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SLAMF6 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slamf6-protein-mouse-hek293-his.html

Purity

96.00

Smiles

EVSQSSSDPQLMNGVLGESAVLPLKLPAGKIANIIIWNYEWEASQVTALVINLSNPESPQIMNTDVKKRLNITQSYSLQISNLTMADTGSYTAQITTKDSEVITFKYILRVFERLGNLETTNYTLLLENGTCQIHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNLSVSVSTQSLCKGVLTNPPWN

Molecular Formula

30925 (Gene_ID) Q9ET39 (E31-N239) (Accession)

Molecular Weight

The protein migrates as an approximately 28-50 kDa band under reducing SDS-PAGE due to glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAP2D (PLPPR5) Human qPCR Primer Pair (NM_001037317)
HP229589 200 Reactions

PAP2D (PLPPR5) Human qPCR Primer Pair (NM_001037317)

Sign In for Pricing
View Details
C4BPB (NM_001017365) Human Over-expression Lysate
LY422639 100 µg

C4BPB (NM_001017365) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ALDH16A1 activation kit by CRISPRa
GA114919 1 Kit

Human ALDH16A1 activation kit by CRISPRa

Sign In for Pricing
View Details
SLC39A3 Rabbit Polyclonal Antibody
AP31254PU-N 50 µg

SLC39A3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human IgM Antibody
KC-2885-01 50 μL

Anti-Human IgM Antibody

Sign In for Pricing
View Details
Anti-Human IgM Antibody
KC-2885-02 100 µL

Anti-Human IgM Antibody

Sign In for Pricing
View Details