Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Candidapepsin-2 (SAP2)

Product Specifications

Product Name Alternative

ACP 2 Aspartate protease 2 Secreted aspartic protease 2

Abbreviation

Recombinant Candida albicans SAP2 protein

Gene Name

SAP2

UniProt

P0CS83

Expression Region

57-398aa

Organism

Candida albicans (Yeast)

Target Sequence

QAVPVTLHNEQVTYAADITVGSNNQKLNVIVDTGSSDLWVPDVNVDCQVTYSDQTADFCKQKGTYDPSGSSASQDLNTPFKIGYGDGSSSQGTLYKDTVGFGGVSIKNQVLADVDSTSIDQGILGVGYKTNEAGGSYDNVPVTLKKQGVIAKNAYSLYLNSPDAATGQIIFGGVDNAKYSGSLIALPVTSDRELRISLGSVEVSGKTINTDNVDVLLDSGTTITYLQQDLADQIIKAFNGKLTQDSNGNSFYEVDCNLSGDVVFNFSKNAKISVPASEFAASLQGDDGQPYDKCQLLFDVNDANILGDNFLRSAYIVYDLDDNEISLAQVKYTSASSISALT

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Catalytic activity Preferential cleavage at the carboxyl of hydrophobic amino acids, but fails to cleave 15-Leu-|-Tyr-16, 16-Tyr-|-Leu-17 and 24-Phe-|-Phe-25 of insulin B chain. Activates trypsinogen, and degrades keratin.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.4 kDa

References & Citations

"Analysis of secreted aspartic proteinases from Candida albicans: purification and characterization of individual Sap1, Sap2 and Sap3 isoenzymes." Smolenski G., Sullivan P.A., Cutfield S.M., Cutfield J.F. Microbiology 143:349-356 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
BNC400226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
BNC680806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-500 1x 500 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF640R conjugate, 0.1mg/mL
BNC400193-500 1x 500 µL

CD86 (BU63), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
BNC470040-100 1x 100 µL

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-100 1x 100 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details