Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia phage 933W Shiga-like toxin 2 subunit B (stxB2)

Product Specifications

Product Name Alternative

Verocytotoxin 2 subunit B ; Verotoxin 2 subunit B

Abbreviation

Recombinant Escherichia phage 933W stxB2 protein

Gene Name

StxB2

UniProt

P09386

Expression Region

20-89aa

Organism

Escherichia phage 933W (Bacteriophage 933W)

Target Sequence

ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Others

Relevance

The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

10.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reg3b Antibody, Biotin conjugated
A50653-50UG 50 µg

Reg3b Antibody, Biotin conjugated

Sign In for Pricing
View Details
GPAM Polyclonal Antibody
bs-5063R 100 µL

GPAM Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Genomic DNA, Prostate
CD564868 5 µg

Tissue Genomic DNA, Prostate

Sign In for Pricing
View Details
Bovine Rho-associated protein kinase 1, ROCK1 ELISA KIT
ELI-15154b 96 Tests

Bovine Rho-associated protein kinase 1, ROCK1 ELISA KIT

Sign In for Pricing
View Details
Manganese Dioxide
M5111-01 5 g

Manganese Dioxide

Sign In for Pricing
View Details
Manganese Dioxide
M5111-02 25 g

Manganese Dioxide

Sign In for Pricing
View Details