Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Osteomodulin, Human (HEK293, His)

Osteomodulin is a potential contributor to the biomineralization process, exerting its functional role through α (V) β (3) -integrin binding to osteoblasts. This interaction highlights its importance in bone-related cellular activities, affecting osteoblast function and potentially bone formation and remodeling. Osteomodulin Protein, Human (HEK293, His) is the recombinant human-derived Osteomodulin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Osteomodulin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/osteomodulin-protein-human-hek293-his.html

Purity

95.0

Smiles

QYETYQWDEDYDQEPDDDYQTGFPFRQNVDYGVPFHQYTLGCVSECFCPTNFPSSMYCDNRKLKTIPNIPMHIQQLYLQFNEIEAVTANSFINATHLKEINLSHNKIKSQKIDYGVFAKLPNLLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLDLCYNYLHDSLLKDKIFAKMEKLMQLNLCSNRLESMPPGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIPRNLEHLYLQNNEIEKMNLTVMCPSIDPLHYHHLTYIRVDQNKLKEPISSYIFFCFPHIHTIYYGEQRSTNGQTIQLKTQVFRRFPDDDDESEDHDDPDNAHESPEQEGAEGHFDLHYYENQE

Molecular Formula

4958 (Gene_ID) Q99983 (Q21-E421) (Accession)

Molecular Weight

50-70 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OVA Conjugated Human Follicle Stimulating Hormone Beta (FSHb)
RPU50075-01 50 µg

OVA Conjugated Human Follicle Stimulating Hormone Beta (FSHb)

Sign In for Pricing
View Details
OVA Conjugated Human Follicle Stimulating Hormone Beta (FSHb)
RPU50075-02 100 µg

OVA Conjugated Human Follicle Stimulating Hormone Beta (FSHb)

Sign In for Pricing
View Details
OVA Conjugated Human Follicle Stimulating Hormone Beta (FSHb)
RPU50075-03 1 mg

OVA Conjugated Human Follicle Stimulating Hormone Beta (FSHb)

Sign In for Pricing
View Details
EBP1
314300-01 50 µg

EBP1

Sign In for Pricing
View Details
EBP1
314300-02 100 µg

EBP1

Sign In for Pricing
View Details
Human DENND3 Protein Lysate
MBS8410449-01 0.02 mg

Human DENND3 Protein Lysate

Sign In for Pricing
View Details