Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2D1, Human (GST)

The UBE2D1 protein is critical in cellular processes. It accepts ubiquitin from the E1 complex and preferentially catalyzes "Lys-48"-linked polyubiquitination in vitro, demonstrating multifunctionality. It mediates the selective degradation of short-lived and aberrant proteins and is involved in E6/E6-AP-induced ubiquitination of p53/TP53. UBE2D1 Protein, Human (GST) is the recombinant human-derived UBE2D1 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

UBE2D1 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2d1-protein-human-gst.html

Purity

98.0

Smiles

MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

Molecular Formula

7321 (Gene_ID) P51668 (M1-M147) (Accession)

Molecular Weight

Approximately 40.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNMT2, GST-tag
51102 10 µg

DNMT2, GST-tag

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Bone sialoprotein-binding protein (bbp), partial
MBS1484760 Inquire

Recombinant Staphylococcus aureus Bone sialoprotein-binding protein (bbp), partial

Sign In for Pricing
View Details
Recombinant Clostridium Novyi whiA Protein (aa 1-317)
VAng-Lsx00195-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Novyi whiA Protein (aa 1-317)

Sign In for Pricing
View Details
Lentiviral mouse Gnpnat1 shRNA (UAS) - Lentiviral mouse Gnpnat1 shRNA (UAS, iRFP) (100)
GTR15248451 1 Vial

Lentiviral mouse Gnpnat1 shRNA (UAS) - Lentiviral mouse Gnpnat1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Recombinant Human CD48 Protein, His Tag
E40KMH206 20 µg

Recombinant Human CD48 Protein, His Tag

Sign In for Pricing
View Details
Zebrafish PPM1G Rabbit Polyclonal Antibody (Biotin)
orb2817688 100 µg

Zebrafish PPM1G Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details