Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Disco-interacting protein 2 homolog A (DIP2A), partial

Product Specifications

Product Name Alternative

DIP2 homolog A

Abbreviation

Recombinant Human DIP2A protein, partial

Gene Name

DIP2A

UniProt

Q14689

Expression Region

9-127aa

Organism

Homo sapiens (Human)

Target Sequence

EAAPLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRSDVHTEAVQAALAKYKERKMPMPSKRRSVLVHSS

Tag

C-terminal hFc1-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Epigenetics and Nuclear Signaling

Relevance

May provide positional cues for axon pathfinding and patterning in the central nervous system.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.2 kDa

References & Citations

"Toward a comprehensive characterization of a human cancer cell phosphoproteome." Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J., Mohammed S. J. Proteome Res. 12:260-271 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,20-Bis(ethylenedioxy)pregna-5,7-diene
TRC-B433805-25MG 25 mg

3,20-Bis(ethylenedioxy)pregna-5,7-diene

Sign In for Pricing
View Details
Vented Plant TC Test Tubes
VTT21 21 Each

Vented Plant TC Test Tubes

Sign In for Pricing
View Details
Recombinant HCoV-NL63 S1+S2 Protein (ECD, His Tag)
PKSV030111 100 µg

Recombinant HCoV-NL63 S1+S2 Protein (ECD, His Tag)

Sign In for Pricing
View Details
SARS-CoV-2 N Protein Mouse Monoclonal Antibody [Clone ID: OTI4B9]
CF814506 100 µg

SARS-CoV-2 N Protein Mouse Monoclonal Antibody [Clone ID: OTI4B9]

Sign In for Pricing
View Details
HPV16 E1/E4 (Human Papilloma Virus 16) (HPV16 E1/E4), CF405S conjugate, 0.1mg/mL
BNC043066-100 1x 100 µL

HPV16 E1/E4 (Human Papilloma Virus 16) (HPV16 E1/E4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 Antibody
KC-610-01 50 μL

CD81 Antibody

Sign In for Pricing
View Details