Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Fibroblast growth factor 2 (FGF2)

Product Specifications

Product Name Alternative

(FGF-2) (Basic fibroblast growth factor) (bFGF) (Heparin-binding growth factor 2) (HBGF-2)

Abbreviation

Recombinant Bovine FGF2 protein

Gene Name

FGF2

UniProt

P03969

Expression Region

10-155aa

Organism

Bos taurus (Bovine)

Target Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.5 kDa

References & Citations

"Involvement of pro-inflammatory cytokines, mediators of inflammation, and basic fibroblast growth factor in prostaglandin F2alpha-induced luteolysis in bovine corpus luteum." Neuvians T.P., Schams D., Berisha B., Pfaffl M.W. Biol Reprod 70:473-480 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ING5 Monoclonal Antibody
AN301566L-01 50 µL

Recombinant ING5 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant ING5 Monoclonal Antibody
AN301566L-02 100 µL

Recombinant ING5 Monoclonal Antibody

Sign In for Pricing
View Details
EGFR (GFR1195), CF568 conjugate, 0.1mg/mL
BNC681195-100 1x 100 µL

EGFR (GFR1195), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Involucrin (Squamous Cell Terminal Differentiation Marker) (IVRN/2113R), 0.2mg/mL
BNUB2113-100 1x 100 µL

Involucrin (Squamous Cell Terminal Differentiation Marker) (IVRN/2113R), 0.2mg/mL

Sign In for Pricing
View Details
Phalloidin, CF®647, 50 U
#00041-T 1x 50 U

Phalloidin, CF®647, 50 U

Sign In for Pricing
View Details
CD63 (Mouse) Recombinant Monoclonal Rat Antibody (24MS05.63), CF®647Plus Conjugate - Biotium Choice
P020-647P-500 1x 500 µL

CD63 (Mouse) Recombinant Monoclonal Rat Antibody (24MS05.63), CF®647Plus Conjugate - Biotium Choice

Sign In for Pricing
View Details