Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17B, Human (HEK293, Fc)

IL-17B is a proinflammatory cytokine and stimulates the release of tumour necrosis factor alpha (TNFα) and IL-1β. IL-17B plays an important role in cancer progression, angiogenesis, and inflammatory arthritis[1][2]. IL-17B Protein, Human (HEK293, Fc) is a recombinant human IL-17B protein with hFc tag at the C-terminus and is expressed in HEK293 cells.

Product Specifications

Product Name Alternative

IL-17B Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17b-protein-human-hek293-fc.html

Purity

98.0

Smiles

QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF

Molecular Formula

27190 (Gene_ID) Q9UHF5 (Q21-F180) (Accession)

Molecular Weight

Approximately 48 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Sanders AJ, et al. IL-17B Can Impact on Endothelial Cellular Traits Linked to Tumour Angiogenesis. J Oncol. 2010;2010:817375. |[2]Bastid J, et al. The Emerging Role of the IL-17B/IL-17RB Pathway in Cancer. Front Immunol. 2020 Apr 21;11:718.|[3]Sanders A, et al. Impact of IL17B on Endothelial Cells and Angiogenesis. Cancer Research, 2009, 69 (24_Supplement) : 2157-2157.|[4]Laprevotte E, et al. The IL-17B-IL-17 receptor B pathway promotes resistance to paclitaxel in breast tumors through activation of the ERK1/2 pathway. Oncotarget. 2017 Dec 6;8 (69) :113360-113372.|[5]Shi Y, et al. A novel cytokine receptor-ligand pair. Identification, molecular characterization, and in vivo immunomodulatory activity. J Biol Chem. 2000 Jun 23;275 (25) :19167-76.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC110 (NM_152775) Human Over-expression Lysate
LY407269 100 µg

CCDC110 (NM_152775) Human Over-expression Lysate

Sign In for Pricing
View Details
PGK1P2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1634906 1.0 µg DNA

PGK1P2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Adiponectin antibody
10R-1018 100 ul

Adiponectin antibody

Sign In for Pricing
View Details
Lentiviral human CALML4 shRNA (UAS) - Lentiviral human CALML4 shRNA (UAS, RFP) (25)
GTR15329438 1 Vial

Lentiviral human CALML4 shRNA (UAS) - Lentiviral human CALML4 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
IL33 Rabbit pAb, PE-Cy5 conjugated
orb2874253 100 µL

IL33 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
G0S2 Polyclonal Antibody, HRP Conjugated
A50230-100 100 µL

G0S2 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details