What is the catalog number for TXNDC17, Human?

The catalog number for TXNDC17, Human is HY-P77268.

What sizes are available for TXNDC17, Human?

TXNDC17, Human is available in the following size(s): 1 Each.

Is TXNDC17, Human in stock?

TXNDC17, Human is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures TXNDC17, Human?

TXNDC17, Human is manufactured by QuantiMol.

What is the estimated delivery time for TXNDC17, Human?

Estimated delivery time for TXNDC17, Human is approximately 15 business day(s), depending on your location.

TXNDC17, Human

Product Specifications

Product Name Alternative

E. coli

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/txndc17-protein-human.html

Purity

98.0

Smiles

MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED

Molecular Weight

Approximately 13.9 kDa

Shipping Conditions

Blue Ice

Storage Conditions

Stored at -20°C for 2 years

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS539856-01 2 mg

Goat anti Mouse IgG (H + L)

Sign In for Pricing

View Details

MBS539856-02 5x 2 mg

Goat anti Mouse IgG (H + L)

Sign In for Pricing

View Details

E55A07383 50 Tests

Human IL10 Antibody , FITC

Sign In for Pricing

View Details

GTR10375633 96 Well

Rabbit Olfactory receptor 5H2 (OR5H2) ELISA kit

Sign In for Pricing

View Details

orb2891353 100 µL

R3HDM2 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing

View Details

TR503215 1 Kit

Mast1 Mouse shRNA Plasmid (Locus ID 56527)

Sign In for Pricing

View Details