What is the catalog number for TXNDC17, Human?

The catalog number for TXNDC17, Human is HY-P77268.

What sizes are available for TXNDC17, Human?

TXNDC17, Human is available in the following size(s): 1 Each.

Is TXNDC17, Human in stock?

TXNDC17, Human is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures TXNDC17, Human?

TXNDC17, Human is manufactured by QuantiMol.

What is the estimated delivery time for TXNDC17, Human?

Estimated delivery time for TXNDC17, Human is approximately 15 business day(s), depending on your location.

TXNDC17, Human

Product Specifications

Product Name Alternative

E. coli

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/txndc17-protein-human.html

Purity

98.0

Smiles

MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED

Molecular Weight

Approximately 13.9 kDa

Shipping Conditions

Blue Ice

Storage Conditions

Stored at -20°C for 2 years

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

K52010C06C07C-01 50 ug

IFIH1 Antibody

Sign In for Pricing

View Details

K52010C06C07C-02 100 ug

IFIH1 Antibody

Sign In for Pricing

View Details

K52010C06C07C-03 1 mg

IFIH1 Antibody

Sign In for Pricing

View Details

E18-3143-1 50 µg - 50 µL

Phospho-Tau (Ser356) Antibody

Sign In for Pricing

View Details

GTR10352583 96 Well

Sheep Cysteine rich PDZ binding protein (CRIPT) ELISA Kit

Sign In for Pricing

View Details

K4630108 1.0 µg DNA

Coro2b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing

View Details