Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCL15, Mouse (HEK293, His)

CXCL15, also known as Lungkine or WECHE, is a member of the ELR motif-containing CXC chemokines. CXCL15 has neutrophil chemotactic activity. CXCL15 is high expression in the lungs of mice[1][2]. CXCL15 Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 142 amino acids (Q26-A167) .

Product Specifications

Product Name Alternative

CXCL15 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcl15-protein-mouse-hek-293-his.html

Purity

95.90

Smiles

QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA

Molecular Formula

20309 (Gene_ID) Q9WVL7 (Q26-A167) (Accession)

Molecular Weight

20-22 kDa

References & Citations

[1]Hal E Broxmeyer, et al. CXCL15/Lungkine has suppressive activity on proliferation and expansion of multi-potential, erythroid, granulocyte and macrophage progenitors in S-phase specific manner. Blood Cells Mol Dis. 2021 Nov;91:102594.|[2]James J Zhu, et al. A novel bovine CXCL15 gene in the GRO chemokine gene cluster. Vet Immunol Immunopathol. 2020 Feb;220:109990.|[3]Julia M Schmitz, et al. Expression of CXCL15 (Lungkine) in murine gastrointestinal, urogenital, and endocrine organs. J Histochem Cytochem. 2007 May;55 (5) :515-24.|[4]Zoila A Lopez-Bujanda, et al. Castration-mediated IL-8 promotes myeloid infiltration and prostate cancer progression. Nat Cancer. 2021 Aug;2 (8) :803-818.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Man1a sgRNA CRISPR Lentivector (Mouse) (Target 3)
K5022704 1.0 µg DNA

Man1a sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
CA12 Polyclonal Antibody, Cy5 Conjugated
bs-6025R-Cy5 100 µL

CA12 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Anti-GRK2 Rabbit pAb
GB115552-50 50 μL

Anti-GRK2 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Neorickettsia sennetsu Ferredoxin--NADP reductase (NSE_0779)
MBS1316233-01 0.02 mg (E-Coli)

Recombinant Neorickettsia sennetsu Ferredoxin--NADP reductase (NSE_0779)

Sign In for Pricing
View Details
Recombinant Neorickettsia sennetsu Ferredoxin--NADP reductase (NSE_0779)
MBS1316233-02 0.02 mg (Yeast)

Recombinant Neorickettsia sennetsu Ferredoxin--NADP reductase (NSE_0779)

Sign In for Pricing
View Details
Recombinant Neorickettsia sennetsu Ferredoxin--NADP reductase (NSE_0779)
MBS1316233-03 0.1 mg (E-Coli)

Recombinant Neorickettsia sennetsu Ferredoxin--NADP reductase (NSE_0779)

Sign In for Pricing
View Details