Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-3 alpha/CCL20, Human (CHO)

MIP-3 alpha/CCL20 Protein, Human (CHO) is a CC chemokine that attracts lymphocytes and mild neutrophils by binding to and acting on the chemokine receptor CCR6. It induces intracellular calcium mobilization and mediates cancer, various autoimmune diseases, and antimicrobial effects. MIP-3 alpha/CCL20 Protein, Human (CHO) is a recombinant human CCL20 (A27-M96) expressed by CHO cells[1].

Product Specifications

Product Name Alternative

MIP-3 alpha/CCL20 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-3-alpha-ccl20-protein-human-cho.html

Purity

98.00

Smiles

ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

Molecular Formula

6364 (Gene_ID) P78556-1 (A27-M96) (Accession)

Molecular Weight

Approximately 8 kDa

References & Citations

[1]Louis Boafo Kwantwi, et al. Multifaceted roles of CCL20 (C-C motif chemokine ligand 20) : mechanisms and communication networks in breast cancer progression. Bioengineered. 2021 Dec;12 (1) :6923-6934.|[2]M Baba, et al. Identification of CCR6, the specific receptor for a novel lymphocyte-directed CC chemokine LARC. J Biol Chem. 1997 Jun 6;272 (23) :14893-8.|[3]M Soledad Hielpos, et al. CCL20 and Beta-Defensin 2 Production by Human Lung Epithelial Cells and Macrophages in Response to Brucella abortus Infection. PLoS One. 2015 Oct 8;10 (10) :e0140408.|[4]A Izadpanah, et al. Regulated MIP-3alpha/CCL20 production by human intestinal epithelium: mechanism for modulating mucosal immunity. Am J Physiol Gastrointest Liver Physiol. 2001 Apr;280 (4) :G710-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM5B Recombinant Rabbit Monoclonal Antibody [PSH03-97]
HA722076 100 µL

KDM5B Recombinant Rabbit Monoclonal Antibody [PSH03-97]

Sign In for Pricing
View Details
Sdha Mouse Gene Knockout Kit (CRISPR)
KN515430 1 Kit

Sdha Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Spaca1 Mouse Gene Knockout Kit (CRISPR)
KN516518 1 Kit

Spaca1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Interleukin 11 Receptor Alpha (IL11Ra) ELISA Kit
RDR-IL11Ra-Mu-01 96 Tests

Mouse Interleukin 11 Receptor Alpha (IL11Ra) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 11 Receptor Alpha (IL11Ra) ELISA Kit
RDR-IL11Ra-Mu-02 48 Tests

Mouse Interleukin 11 Receptor Alpha (IL11Ra) ELISA Kit

Sign In for Pricing
View Details
Apigenin 4'-O-Beta-D-Glucuronide Sodium Salt (~90%)
TRC-A726513-5MG 5 mg

Apigenin 4'-O-Beta-D-Glucuronide Sodium Salt (~90%)

Sign In for Pricing
View Details