Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG2B Fc, Llama (HEK293)

IgG2B Fc Protein, Llama (HEK293) is the recombinant IgG2B Fc protein, expressed by HEK293, with tag free.

Product Specifications

Product Name Alternative

IgG2B Fc Protein, Llama (HEK293), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg2b-fc-protein-llama.html

Purity

95.00

Smiles

EPKTPKPQPQPQPQPNPTTESKCPKCPAPELLGGPSVFIFPPKPKDVLSISGRPEVTCVVVDVGQEDPEVSFNWYIDGAEVRTANTRPKEEQFNSTYRVVSVLPIQHQDWLTGKEFKCKVNNKALPAPIEKTISKAKGQTREPQVYALAPHREELAKDTVSVTCLVKGFYPPDINVEWQRNRQPEPEGTYATTPPQLDNDGTYFLYSKLSVGKNTWQRGETFTCVVMHETLHNHYTQKSISQS

Molecular Formula

/ (Gene_ID) AAX73259.1 (E1-S243) (Accession)

Molecular Weight

Approximately 35-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL
BNC941035-100 1x 100 µL

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL
BNC880965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-100 1x 100 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-100 1x 100 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF740 conjugate, 0.1mg/mL
BNC740189-100 1x 100 µL

CD74 (BU45), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PCRP-TP53-1F7), CF647 conjugate, 0.1mg/mL
BNC471925-100 1x 100 µL

P53 Tumor Suppressor Protein (PCRP-TP53-1F7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details