Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macadamia integrifolia Antimicrobial peptide 1

Product Specifications

Product Name Alternative

(AMP1) (MiAMP1)

Abbreviation

Recombinant Macadamia integrifolia Antimicrobial peptide 1 protein

UniProt

P80915

Expression Region

27-102aa

Organism

Macadamia integrifolia (Macadamia nut)

Target Sequence

SAFTVWSGPGCNNRAERYSKCGCSAIHQKGGYDFSYTGQTAALYNQAGCSGVAHTRFGSSARACNPFGWKSIFIQC

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Kits/ Lysates/ Other

Relevance

Catalyzes the removal of terminal sialic acid residues from viral and cellular glycoconjugates. Cleaves off the terminal sialic acids on the glycosylated HA during virus budding to facilitate virus release. Additionally helps virus spread through the circulation by further removing sialic acids from the cell surface. These cleavages prevent self-aggregation and ensure the efficient spread of the progeny virus from cell to cell. Otherwise, infection would be limited to one round of replication. Described as a receptor-destroying enzyme because it cleaves a terminal sialic acid from the cellular receptors. May facilitate viral invasion of the upper airways by cleaving the sialic acid moieties on the mucin of the airway epithelial cells. Likely to plays a role in the budding process through its association with lipid rafts during intracellular transport. May additionally display a raft-association independent effect on budding. Plays a role in the determination of host range restriction on replication and virulence. Sialidase activity in late endosome/lysosome traffic seems to enhance virus replication.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.0 kDa

References & Citations

"Sialobiology of influenza: molecular mechanism of host range variation of influenza viruses." Suzuki Y. Biol. Pharm. Bull. 28:399-408 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat SLC7A7 shRNA Plasmid
abx986776-01 150 µg

Rat SLC7A7 shRNA Plasmid

Ask
View Details
Rat SLC7A7 shRNA Plasmid
abx986776-02 300 µg

Rat SLC7A7 shRNA Plasmid

Ask
View Details
FLJ23584 (NM_024588) Human Tagged ORF Clone Lentiviral Particle
RC203355L3V 200 µL

FLJ23584 (NM_024588) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Zcchc18 (NM_001035510) Mouse Tagged Lenti ORF Clone
MR206148L3 10 µg

Zcchc18 (NM_001035510) Mouse Tagged Lenti ORF Clone

Ask
View Details
DOCK2 (12V7) Mouse Monoclonal antibody
E28PE2416 100 µL

DOCK2 (12V7) Mouse Monoclonal antibody

Ask
View Details