Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Guinea (N-His)

TNF-alpha/TNFSF2 protein binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing cell death in specific tumors and causing fever. It can also stimulate cell proliferation, induce insulin resistance, promote angiogenesis, and mediate bone resorption. TNF-alpha's intracellular domain induces IL12 production, highlighting its diverse physiological impact. TNF-alpha/TNFSF2 Protein, Guinea (N-His) is the recombinant TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Guinea (N-His), Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-guinea-n-his.html

Purity

95.0

Smiles

LRSASQNDNDKPVAHVVANQQAEEELQWLSKRANALLANGMGLSDNQLVVPSDGLYLIYSQVLFKGQGCPSYLLLTHTVSRLAVSYPEKVNLLSAIKSPCQKETPEGAERKPWYEPIYLGGVFQLQKGDRLSAEVNLPQYLDFADSGQIYFGVIAL

Molecular Formula

100135630 (Gene_ID) P51435 (L79-L234) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLA1A Antibody
orb620727 100 µL

PLA1A Antibody

Sign In for Pricing
View Details
NALCN Antibody
OACA09618-100UG 100 µg

NALCN Antibody

Sign In for Pricing
View Details
MacConkey Broth Purple Double Strength w/ BCP
57608-1 500 Gms

MacConkey Broth Purple Double Strength w/ BCP

Sign In for Pricing
View Details
COPS3 Antibody - middle region
OASG01879-100UL 100 µL

COPS3 Antibody - middle region

Sign In for Pricing
View Details
Mouse Pdx1 Pre-designed siRNA Set A
SI110342A 1 Each

Mouse Pdx1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
1- (2-HYDROXYETHYL) -1,2,4-TRIAZOLE
TD1721-01 2 mg

1- (2-HYDROXYETHYL) -1,2,4-TRIAZOLE

Sign In for Pricing
View Details