Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A8, Rat (His)

S100A8 protein functions as a danger signal in inflammation, activating innate immune cells by binding to receptors like Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER) . This triggers signaling pathways that enhance the pro-inflammatory response. S100A8 Protein, Rat (His) is the recombinant rat-derived S100A8 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A8 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a8-protein-rat-his.html

Purity

95.0

Smiles

MATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE

Molecular Formula

116547 (Gene_ID) P50115 (M1-E89) (Accession)

Molecular Weight

Approximately 13.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL-23R Domain1 (C-hFc)
32-9847-500 500 µg

Recombinant Human IL-23R Domain1 (C-hFc)

Sign In for Pricing
View Details
PAP2c Rabbit Polyclonal Antibody (PE)
orb485778 100 µL

PAP2c Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
OsSPX1 Rabbit pAb
orb2706192-01 50 µL

OsSPX1 Rabbit pAb

Sign In for Pricing
View Details
OsSPX1 Rabbit pAb
orb2706192-02 100 µL

OsSPX1 Rabbit pAb

Sign In for Pricing
View Details
Tannin Microplate Assay Kit
MBS4504417-01 100 Assays

Tannin Microplate Assay Kit

Sign In for Pricing
View Details
Tannin Microplate Assay Kit
MBS4504417-02 5x 100 Assays

Tannin Microplate Assay Kit

Sign In for Pricing
View Details