Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCN2/CTGF, Human (HEK293)

CCN2/CTGF (Connective Tissue Growth Factor) is a protein produced primarily by endothelial cells in blood vessels. It plays an important role in various cellular processes. CCN2/CTGF Protein, Human (HEK293) is the recombinant human-derived CCN2/CTGF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

CCN2/CTGF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctgf-protein-human-hek-293.html

Purity

98.00

Smiles

QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA

Molecular Formula

1490 (Gene_ID) Q5M8T4 (Q27-A180) (Accession)

Molecular Weight

Approximately 16-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PECR Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E12]
TA501964AM 100 µL

PECR Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E12]

Sign In for Pricing
View Details
Cytokeratin, Multi (Epithelial Marker) (KRT/1877R), CF488A conjugate, 0.1mg/mL
BNC881877-100 1x 100 µL

Cytokeratin, Multi (Epithelial Marker) (KRT/1877R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS645968 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
POLA2 (NM_002689) Human Over-expression Lysate
LY419168 100 µg

POLA2 (NM_002689) Human Over-expression Lysate

Sign In for Pricing
View Details
Telapristone Acetate
TRC-T291665-1MG 1 mg

Telapristone Acetate

Sign In for Pricing
View Details
SARS2 (N-term) Rabbit Polyclonal Antibody
AP14668PU-N 400 µL

SARS2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details