Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCN2/CTGF, Human (HEK293)

CCN2/CTGF (Connective Tissue Growth Factor) is a protein produced primarily by endothelial cells in blood vessels. It plays an important role in various cellular processes. CCN2/CTGF Protein, Human (HEK293) is the recombinant human-derived CCN2/CTGF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

CCN2/CTGF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctgf-protein-human-hek-293.html

Purity

98.00

Smiles

QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA

Molecular Formula

1490 (Gene_ID) Q5M8T4 (Q27-A180) (Accession)

Molecular Weight

Approximately 16-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tosylurethane
TRC-T686900-1G 1 g

Tosylurethane

Sign In for Pricing
View Details
Breast cancer suppressor candidate 1 (VWA5A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D6]
TA501569BM 100 µL

Breast cancer suppressor candidate 1 (VWA5A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D6]

Sign In for Pricing
View Details
Dynamin 1 Rabbit Polyclonal Antibody
ER1802-77 100 µL

Dynamin 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FXYD1 (NM_001278718) Human Tagged ORF Clone
RG235561 10 µg

FXYD1 (NM_001278718) Human Tagged ORF Clone

Sign In for Pricing
View Details
1-phenyl-2-(propylamino)-1-Butanone Hydrochloride
TRC-P162950-2.5MG 2.5 mg

1-phenyl-2-(propylamino)-1-Butanone Hydrochloride

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS808177 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details