Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCN2/CTGF, Human (HEK293)

CCN2/CTGF (Connective Tissue Growth Factor) is a protein produced primarily by endothelial cells in blood vessels. It plays an important role in various cellular processes. CCN2/CTGF Protein, Human (HEK293) is the recombinant human-derived CCN2/CTGF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

CCN2/CTGF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctgf-protein-human-hek-293.html

Purity

98.00

Smiles

QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA

Molecular Formula

1490 (Gene_ID) Q5M8T4 (Q27-A180) (Accession)

Molecular Weight

Approximately 16-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

bmpA, BB_0383 Rabbit Polyclonal Antibody
TA396883 100 µg

bmpA, BB_0383 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RASA1 (NM_002890) Human Over-expression Lysate
LC401014 20 µg

RASA1 (NM_002890) Human Over-expression Lysate

Sign In for Pricing
View Details
Calcineurin B (PPP3R1) (NM_000945) Human Over-expression Lysate
LY424440 100 µg

Calcineurin B (PPP3R1) (NM_000945) Human Over-expression Lysate

Sign In for Pricing
View Details
C6orf226 Human Gene Knockout Kit (CRISPR)
KN420927 1 Kit

C6orf226 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (PL8-F6), CF640R conjugate, 0.1mg/mL
BNC400889-500 1x 500 µL

PLAP (Placental Alkaline Phosphatase) (PL8-F6), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KREMEN1 (NM_032045) Human Over-expression Lysate
LC429793 20 µg

KREMEN1 (NM_032045) Human Over-expression Lysate

Sign In for Pricing
View Details