Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCN2/CTGF, Human (HEK293)

CCN2/CTGF (Connective Tissue Growth Factor) is a protein produced primarily by endothelial cells in blood vessels. It plays an important role in various cellular processes. CCN2/CTGF Protein, Human (HEK293) is the recombinant human-derived CCN2/CTGF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

CCN2/CTGF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctgf-protein-human-hek-293.html

Purity

98.00

Smiles

QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA

Molecular Formula

1490 (Gene_ID) Q5M8T4 (Q27-A180) (Accession)

Molecular Weight

Approximately 16-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse PHD Finger Protein 8 (PHF8) ELISA Kit
RD-PHF8-Mu-01 96 Tests

Mouse PHD Finger Protein 8 (PHF8) ELISA Kit

Sign In for Pricing
View Details
Mouse PHD Finger Protein 8 (PHF8) ELISA Kit
RD-PHF8-Mu-02 48 Tests

Mouse PHD Finger Protein 8 (PHF8) ELISA Kit

Sign In for Pricing
View Details
Human LIMD1 activation kit by CRISPRa
GA105981 1 Kit

Human LIMD1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Lilr4b activation kit by CRISPRa
GA201685 1 Kit

Mouse Lilr4b activation kit by CRISPRa

Sign In for Pricing
View Details
ARF1 (Golgi Apparatus Marker) (ARF1/2117), 1mg/mL
BNUM2117-50 1x 50 µL

ARF1 (Golgi Apparatus Marker) (ARF1/2117), 1mg/mL

Sign In for Pricing
View Details
AFP Recombinant Rabbit monoclonal Antibody
HA723371 100 µL

AFP Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details