Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCN2/CTGF, Human (HEK293)

CCN2/CTGF (Connective Tissue Growth Factor) is a protein produced primarily by endothelial cells in blood vessels. It plays an important role in various cellular processes. CCN2/CTGF Protein, Human (HEK293) is the recombinant human-derived CCN2/CTGF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

CCN2/CTGF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctgf-protein-human-hek-293.html

Purity

98.00

Smiles

QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA

Molecular Formula

1490 (Gene_ID) Q5M8T4 (Q27-A180) (Accession)

Molecular Weight

Approximately 16-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SF3B1, NT (SF3B1, SAP155, Splicing factor 3B subunit 1, Pre-mRNA-splicing factor SF3b 155kD subunit, Spliceosome-associated protein 155) (MaxLight 750) discontinued
041612-ML750 100 µL

SF3B1, NT (SF3B1, SAP155, Splicing factor 3B subunit 1, Pre-mRNA-splicing factor SF3b 155kD subunit, Spliceosome-associated protein 155) (MaxLight 750) discontinued

Sign In for Pricing
View Details
RAPSN / Rapsyn Immunizing Peptide
MBS426217-01 0.1 mg

RAPSN / Rapsyn Immunizing Peptide

Sign In for Pricing
View Details
RAPSN / Rapsyn Immunizing Peptide
MBS426217-02 5x 0.1 mg

RAPSN / Rapsyn Immunizing Peptide

Sign In for Pricing
View Details
CB2, CT (CNR2, Cannabinoid receptor 2, CX5) (APC) discontinued
033236-APC 200 µL

CB2, CT (CNR2, Cannabinoid receptor 2, CX5) (APC) discontinued

Sign In for Pricing
View Details
Mtap7d2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3557405 3x 1.0 µg

Mtap7d2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Kv4.2 (Shal1, RK5, Kcnd2, Voltage-gated Potassium Channel) (MaxLight 550) discontinued
K9018-03-ML550 100 µL

Kv4.2 (Shal1, RK5, Kcnd2, Voltage-gated Potassium Channel) (MaxLight 550) discontinued

Sign In for Pricing
View Details