Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-13 (IL13), partial

Product Specifications

Product Name Alternative

IL-13

Abbreviation

Recombinant Human IL13 protein, partial

Gene Name

IL13

UniProt

P35225

Expression Region

21-132aa

Organism

Homo sapiens (Human)

Target Sequence

TVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDL

Tag

C-terminal hFc1-Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Positively regulates IL31RA expression in macrophages.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42 kDa

References & Citations

"Coexpression of the interleukin-13 and interleukin-4 genes correlates with their physical linkage in the cytokine gene cluster on human chromosome 5q23-31." Dolganov G., Bort S., Lovett M., Burr J., Schubert L., Short D., McGurn M., Gibson C., Lewis D.B. Blood 87:3316-3326 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCP1 (CTDP1) Rabbit Polyclonal Antibody
TA372558 100 µL

FCP1 (CTDP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM50A Polyclonal Antibody
E-AB-17943-01 20 µL

FAM50A Polyclonal Antibody

Sign In for Pricing
View Details
FAM50A Polyclonal Antibody
E-AB-17943-02 60 µL

FAM50A Polyclonal Antibody

Sign In for Pricing
View Details
FAM50A Polyclonal Antibody
E-AB-17943-03 120 µL

FAM50A Polyclonal Antibody

Sign In for Pricing
View Details
FAM50A Polyclonal Antibody
E-AB-17943-04 200 µL

FAM50A Polyclonal Antibody

Sign In for Pricing
View Details
ABI2 (NM_001282926) Human Tagged ORF Clone
RG238615 10 µg

ABI2 (NM_001282926) Human Tagged ORF Clone

Sign In for Pricing
View Details