Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-21, Human (His)

FGF-21 Proteinas influences glucose uptake in adipocytes by inducing SLC2A1/GLUT1 expression, particularly with KLB's presence. It plays a crucial role in systemic glucose homeostasis and insulin sensitivity, interacting directly with KLB through its C-terminus and engaging with FGFR4. The protein's molecular mechanisms involve a complex interplay, emphasizing its broad impact beyond localized effects. FGF-21 Protein, Human (His) is the recombinant human-derived FGF-21 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-21 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-21-protein-human-his.html

Purity

98.0

Smiles

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Molecular Formula

26291 (Gene_ID) AAH18404.1 (H29-S209) (Accession)

Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

OLFML2A Antibody
A57862-50UG 50 µg

OLFML2A Antibody

Ask
View Details
ENT2 (SLC29A2) (NM_001532) Human 3' UTR Clone
SC211164 10 µg

ENT2 (SLC29A2) (NM_001532) Human 3' UTR Clone

Ask
View Details
Lentiviral human C11orf49 sgRNA gene knockout kit - Lentiviral human C11orf49 sgRNA gene knockout kit (25)
GTR15392058 1 Vial

Lentiviral human C11orf49 sgRNA gene knockout kit - Lentiviral human C11orf49 sgRNA gene knockout kit (25)

Ask
View Details
FITC-Linked Polyclonal Antibody to Galectin 8 (GAL8)
MBS2040905-01 0.1 mL

FITC-Linked Polyclonal Antibody to Galectin 8 (GAL8)

Ask
View Details
FITC-Linked Polyclonal Antibody to Galectin 8 (GAL8)
MBS2040905-02 0.2 mL

FITC-Linked Polyclonal Antibody to Galectin 8 (GAL8)

Ask
View Details
FITC-Linked Polyclonal Antibody to Galectin 8 (GAL8)
MBS2040905-03 0.5 mL

FITC-Linked Polyclonal Antibody to Galectin 8 (GAL8)

Ask
View Details