BCA-1/CXCL13, Cynomolgus (His)
CXCL13, known as BCA-1 (B cell-attracting chemokine 1) or BLC (B-lymphocyte chemoattractant), is an efficacious attractant selective for B lymphocytes through binding to the BLR1/CXCR5 receptor[1]. CXCL13 is a homeostatic chemokine, and is constitutively secreted by stromal cells in B-cell areas of secondary lymphoid tissues (follicles), such as spleen, lymph nodes, tonsils, and Peyer's patches[2]. BCA-1/CXCL13 Protein, Cynomolgus (His) is produced in E. coli with a N-Terminal His-tag.
Product Specifications
Product Name Alternative
BCA-1/CXCL13 Protein, Cynomolgus (His), Cynomolgus, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/bca-1-cxcl13-protein-cynomolgus-his.html
Purity
96.00
Smiles
VLEVYYTHLRCRCVQESSVFIPRRFIDRIQISPRGNGCPRKEIIVWKKNKSVVCVDPQAEWIQRIMEMLRKKSSSTAPVPVFKRKIP
Molecular Formula
/ (Gene_ID) A0A2K5V497 (V23-P109) (Accession)
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
UBC sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Recombinant Human Killer cell lectin-like receptor subfamily G member 2