Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse DNA Polymerase Lambda (POLL) ELISA Kit

Product Specifications

Applications

ELISA

Notes

This product is for research use only. The range and sensitivity is subject to change. Please contact us for the latest product information. For accurate results, sample concentrations must be diluted to mid-range of the kit. If you require a specific range, please contact us in advance or write your request in your order comments. Please note that our ELISA and CLIA kits are optimised for detection of native samples, rather than recombinant proteins. We are unable to guarantee detection of recombinant proteins, as they may have different sequences or tertiary structures to the native protein.

Tested Applications

ELISA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Placenta Growth Factor (PIGF) ELISA Kit
MBS2610849-01 48 Well

Rabbit Placenta Growth Factor (PIGF) ELISA Kit

Sign In for Pricing
View Details
Rabbit Placenta Growth Factor (PIGF) ELISA Kit
MBS2610849-02 96 Well

Rabbit Placenta Growth Factor (PIGF) ELISA Kit

Sign In for Pricing
View Details
Rabbit Placenta Growth Factor (PIGF) ELISA Kit
MBS2610849-03 5x 96 Well

Rabbit Placenta Growth Factor (PIGF) ELISA Kit

Sign In for Pricing
View Details
Rabbit Placenta Growth Factor (PIGF) ELISA Kit
MBS2610849-04 10x 96 Well

Rabbit Placenta Growth Factor (PIGF) ELISA Kit

Sign In for Pricing
View Details
Peptide Sequence (MLSKTVAPPQQARVSRKAIRAVPMMKNVNEGKGLFAPLVVVTRNIVGKKRFNQLRGKAIALHSQVITEFCKSIGADAKQRQGLIRLAKKNGERLGFLA)
462218 1 mg

Peptide Sequence (MLSKTVAPPQQARVSRKAIRAVPMMKNVNEGKGLFAPLVVVTRNIVGKKRFNQLRGKAIALHSQVITEFCKSIGADAKQRQGLIRLAKKNGERLGFLA)

Sign In for Pricing
View Details
Anti-CD20 Antibody (3J782)
TMAC-00674-01 50 μL

Anti-CD20 Antibody (3J782)

Sign In for Pricing
View Details