Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSP, Human (His)

PSP protein catalyzes the final irreversible step in carbohydrate biosynthesis of L-serine through dephosphorylation of O-phospho-L-serine. PSP Protein, Human (His) is the recombinant human-derived PSP protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PSP Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/psp-protein-human-his.html

Purity

98.0

Smiles

MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE

Molecular Formula

5723 (Gene_ID) P78330 (M1-E225) (Accession)

Molecular Weight

25-30 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm7173 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
22200064 1.0 µg DNA

Gm7173 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
DIO2 Antibody
orb418259-01 50 µg

DIO2 Antibody

Sign In for Pricing
View Details
DIO2 Antibody
orb418259-02 100 µg

DIO2 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal MNAT1 Antibody [Alexa Fluor 532]
NBP3-06477AF532 0.1 mL

Rabbit Polyclonal MNAT1 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
Anti-SLC5A7 Antibody Picoband®, Cy3 Conjugate
A05277-1-Cy3 100 µg/Vial

Anti-SLC5A7 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Pcgf5 ORF Vector (Mouse) (pORF)
ORF053556 1.0 µg DNA

Pcgf5 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details