Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSP, Human (His)

PSP protein catalyzes the final irreversible step in carbohydrate biosynthesis of L-serine through dephosphorylation of O-phospho-L-serine. PSP Protein, Human (His) is the recombinant human-derived PSP protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PSP Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/psp-protein-human-his.html

Purity

98.0

Smiles

MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE

Molecular Formula

5723 (Gene_ID) P78330 (M1-E225) (Accession)

Molecular Weight

25-30 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal EPX Antibody (AHE-1) [DyLight 488]
NBP2-34551G 0.1 mL

Mouse Monoclonal EPX Antibody (AHE-1) [DyLight 488]

Sign In for Pricing
View Details
SLC11A2 (Solute Carrier Family 11 Member 2, DCT1, DMT1, NRAMP2, Natural Resistance-associated Macrophage Protein 2, Divalent Cation Transporter 1, Divalent Metal Transporter 1, FLJ37416)
133397 100 µg

SLC11A2 (Solute Carrier Family 11 Member 2, DCT1, DMT1, NRAMP2, Natural Resistance-associated Macrophage Protein 2, Divalent Cation Transporter 1, Divalent Metal Transporter 1, FLJ37416)

Sign In for Pricing
View Details
Recombinant Mouse Chemokine (C-X-C Motif) Ligand 1 (CXCL1)
RPU51465-01 50 µg

Recombinant Mouse Chemokine (C-X-C Motif) Ligand 1 (CXCL1)

Sign In for Pricing
View Details
Recombinant Mouse Chemokine (C-X-C Motif) Ligand 1 (CXCL1)
RPU51465-02 100 µg

Recombinant Mouse Chemokine (C-X-C Motif) Ligand 1 (CXCL1)

Sign In for Pricing
View Details
Recombinant Mouse Chemokine (C-X-C Motif) Ligand 1 (CXCL1)
RPU51465-03 1 mg

Recombinant Mouse Chemokine (C-X-C Motif) Ligand 1 (CXCL1)

Sign In for Pricing
View Details
DDX21 Rabbit Polyclonal Antibody (APC-Cy7)
orb2516894 100 µL

DDX21 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details