Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSP, Human (His)

PSP protein catalyzes the final irreversible step in carbohydrate biosynthesis of L-serine through dephosphorylation of O-phospho-L-serine. PSP Protein, Human (His) is the recombinant human-derived PSP protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PSP Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/psp-protein-human-his.html

Purity

98.0

Smiles

MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE

Molecular Formula

5723 (Gene_ID) P78330 (M1-E225) (Accession)

Molecular Weight

25-30 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD74 Rabbit pAb
GB115427 100 μL

Anti-CD74 Rabbit pAb

Sign In for Pricing
View Details
CD58 Antibody
A16593-100UL 100 µL

CD58 Antibody

Sign In for Pricing
View Details
PTGS2 Antibody
orb1330598 100 µg

PTGS2 Antibody

Sign In for Pricing
View Details
HDLCQ1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0942108 1.0 µg DNA

HDLCQ1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Exenatide-d5 Acetate
CS-O-03498 1 Each

Exenatide-d5 Acetate

Sign In for Pricing
View Details
OriCell™ Complete Medium For A2780 Cell Line
CMH6-2301 500 mL

OriCell™ Complete Medium For A2780 Cell Line

Sign In for Pricing
View Details