Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcriptional enhancer factor TEF-3 (TEAD4), partial

Product Specifications

Product Name Alternative

TEA domain family member 4 Short name: TEAD-4 Transcription factor 13-like 1 Transcription factor RTEF-1

Abbreviation

Recombinant Human TEAD4 protein, partial

Gene Name

TEAD4

UniProt

Q15561

Expression Region

74-434aa

Organism

Homo sapiens (Human)

Target Sequence

MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Transcription

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL-6 Protein (Fc Tag)
PDMH100428-01 20 µg

Recombinant Human IL-6 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human IL-6 Protein (Fc Tag)
PDMH100428-02 100 µg

Recombinant Human IL-6 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human IL-6 Protein (Fc Tag)
PDMH100428-03 500 µg

Recombinant Human IL-6 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human IL-6 Protein (Fc Tag)
PDMH100428-04 1 mg

Recombinant Human IL-6 Protein (Fc Tag)

Sign In for Pricing
View Details
Human TRPV6 activation kit by CRISPRa
GA110762 1 Kit

Human TRPV6 activation kit by CRISPRa

Sign In for Pricing
View Details
Human SLC25A25 activation kit by CRISPRa
GA114454 1 Kit

Human SLC25A25 activation kit by CRISPRa

Sign In for Pricing
View Details