Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNCA, Human (His)

Alpha-synuclein (SNCA) is a key neuronal protein that regulates synaptic activity, including vesicle transport and neurotransmitter release. As a monomer, it enhances vesicle exocytosis, promotes fusion and fusion pore expansion, and increases local Ca (2+) release. SNCA Protein, Human (His) is the recombinant human-derived SNCA protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SNCA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/snca-protein-human-his.html

Purity

98.0

Smiles

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Molecular Formula

6622 (Gene_ID) P37840-1 (M1-A140) (Accession)

Molecular Weight

Approximately 18.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Goat Anti-Mouse/Rabbit IgG (H&L)-HRP Polymer
MBS8326133-01 0.1 mL

Goat Anti-Mouse/Rabbit IgG (H&L)-HRP Polymer

Ask
View Details
Goat Anti-Mouse/Rabbit IgG (H&L)-HRP Polymer
MBS8326133-02 0.5 mL

Goat Anti-Mouse/Rabbit IgG (H&L)-HRP Polymer

Ask
View Details
Goat Anti-Mouse/Rabbit IgG (H&L)-HRP Polymer
MBS8326133-03 1 mL

Goat Anti-Mouse/Rabbit IgG (H&L)-HRP Polymer

Ask
View Details
Goat Anti-Mouse/Rabbit IgG (H&L)-HRP Polymer
MBS8326133-04 5x 1 mL

Goat Anti-Mouse/Rabbit IgG (H&L)-HRP Polymer

Ask
View Details
TMBIM1, NT (TMBIM1, LFG3, RECS1, Protein lifeguard 3, Protein RECS1 homolog, Transmembrane BAX inhibitor motif-containing protein 1) (MaxLight 490)
MBS6356114-01 0.1 mL

TMBIM1, NT (TMBIM1, LFG3, RECS1, Protein lifeguard 3, Protein RECS1 homolog, Transmembrane BAX inhibitor motif-containing protein 1) (MaxLight 490)

Ask
View Details
TMBIM1, NT (TMBIM1, LFG3, RECS1, Protein lifeguard 3, Protein RECS1 homolog, Transmembrane BAX inhibitor motif-containing protein 1) (MaxLight 490)
MBS6356114-02 5x 0.1 mL

TMBIM1, NT (TMBIM1, LFG3, RECS1, Protein lifeguard 3, Protein RECS1 homolog, Transmembrane BAX inhibitor motif-containing protein 1) (MaxLight 490)

Ask
View Details